KEGG   Homo sapiens (human): 55746
Entry
55746             CDS       T01001                                 
Symbol
NUP133, GAMOS8, NPHS18, hNUP133
Name
(RefSeq) nucleoporin 133
  KO
K14300  nuclear pore complex protein Nup133
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  Nucleocytoplasmic transport
hsa05014  Amyotrophic lateral sclerosis
Network
nt06424  RNA processing
nt06464  Amyotrophic lateral sclerosis
  Element
N01152  Nuclear export of mRNA
N01153  Mutation-caused aberrant GLE1 to nuclear export of mRNA
Disease
H01657  Nephrotic syndrome
H01722  Galloway-Mowat syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    55746 (NUP133)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    55746 (NUP133)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    55746 (NUP133)
   03036 Chromosome and associated proteins [BR:hsa03036]
    55746 (NUP133)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     55746 (NUP133)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Spindle formation proteins
    55746 (NUP133)
SSDB
Motif
Pfam: Nucleoporin_C
Other DBs
NCBI-GeneID: 55746
NCBI-ProteinID: NP_060700
OMIM: 607613
HGNC: 18016
Ensembl: ENSG00000069248
Vega: OTTHUMG00000039462
Pharos: Q8WUM0(Tbio)
UniProt: Q8WUM0
Structure
LinkDB
Position
1:complement(229440259..229508341)
AA seq 1156 aa
MFPAAPSPRTPGTGSRRGPLAGLGPGSTPRTASRKGLPLGSAVSSPVLFSPVGRRSSLSS
RGTPTRMFPHHSITESVNYDVKTFGSSLPVKVMEALTLAEVDDQLTINIDEGGWACLVCK
EKLIIWKIALSPITKLSVCKELQLPPSDFHWSADLVALSYSSPSGEAHSTQAVAVMVATR
EGSIRYWPSLAGEDTYTEAFVDSGGDKTYSFLTAVQGGSFILSSSGSQLIRLIPESSGKI
HQHILPQGQGMLSGIGRKVSSLFGILSPSSDLTLSSVLWDRERSSFYSLTSSNISKWELD
DSSEKHAYSWDINRALKENITDAIWGSESNYEAIKEGVNIRYLDLKQNCDGLVILAAAWH
SADNPCLIYYSLITIEDNGCQMSDAVTVEVTQYNPPFQSEDLILCQLTVPNFSNQTAYLY
NESAVYVCSTGTGKFSLPQEKIVFNAQGDSVLGAGACGGVPIIFSRNSGLVSITSRENVS
ILAEDLEGSLASSVAGPNSESMIFETTTKNETIAQEDKIKLLKAAFLQYCRKDLGHAQMV
VDELFSSHSDLDSDSELDRAVTQISVDLMDDYPASDPRWAESVPEEAPGFSNTSLIILHQ
LEDKMKAHSFLMDFIHQVGLFGRLGSFPVRGTPMATRLLLCEHAEKLSAAIVLKNHHSRL
SDLVNTAILIALNKREYEIPSNLTPADVFFREVSQVDTICECLLEHEEQVLRDAPMDSIE
WAEVVINVNNILKDMLQAASHYRQNRNSLYRREESLEKEPEYVPWTATSGPGGIRTVIIR
QHEIVLKVAYPQADSNLRNIVTEQLVALIDCFLDGYVSQLKSVDKSSNRERYDNLEMEYL
QKRSDLLSPLLSLGQYLWAASLAEKYCDFDILVQMCEQTDNQSRLQRYMTQFADQNFSDF
LFRWYLEKGKRGKLLSQPISQHGQLANFLQAHEHLSWLHEINSQELEKAHATLLGLANME
TRYFAKKKTLLGLSKLAALASDFSEDMLQEKIEEMAEQERFLLHQETLPEQLLAEKQLNL
SAMPVLTAPQLIGLYICEENRRANEYDFKKALDLLEYIDEEEDININDLKLEILCKALQR
DNWSSSDGKDDPIEVSKDSIFVKILQKLLKDGIQLSEYLPEVKDLLQADQLGSLKSNPYF
EFVLKANYEYYVQGQI
NT seq 3471 nt   +upstreamnt  +downstreamnt
atgttcccagccgccccttctccgcggaccccgggtaccgggtcccgaaggggcccgctg
gccggactcgggcccggctccacgccccggacggctagcaggaagggtctgcccctgggg
tctgcagtcagctccccagtgctcttctcgccggtcggccggcgtagctcgctaagctcg
cggggaacaccaacacgaatgttcccacaccactccataactgagtctgtgaactatgat
gtgaaaacgtttggatcttctcttcctgttaaagtcatggaagccctaacattggctgaa
gtcgatgaccagctgaccattaacatagatgaaggtggatgggcttgtctggtgtgcaaa
gagaagctcattatttggaagattgctctgtcacctattactaagttatccgtttgcaaa
gaacttcagctgccacctagtgatttccactggagtgccgacttagtggctctttcttac
tcttctccctcaggtgaagcacattctactcaggctgttgctgtcatggttgccaccaga
gaaggatctatccgctattggccaagccttgctggtgaagatacctacacagaggctttt
gtagattcgggaggtgataagacttacagtttcctaacagcagtgcagggaggaagtttt
attttgtcttcatcaggaagccaactaattcggttgatacctgagagctcaggaaagatt
catcagcatatcctgcctcaggggcaaggcatgctttcaggaattggtcgaaaagtttct
tctctttttggaattttatctcctagtagtgatctcacactttcaagtgttctctgggat
agagagagatcaagcttttatagcctgacgagttcaaacatcagtaaatgggaattagat
gattcttcagaaaagcatgcatacagttgggatataaatagagccctgaaggaaaacatt
accgatgctatttggggatctgaaagtaactatgaagctattaaagaaggagtcaacatt
cgatatttggacttgaagcaaaactgtgatgggctggtgattttggcagcagcatggcac
tcagcagacaatccatgtctcatctattactctctgataacaatagaagataatggttgc
caaatgtcagatgcagttactgtagaagtcactcaatataatccaccttttcagtctgaa
gacctgattttgtgtcagttgacggtcccaaacttttcaaaccagactgcctatctgtat
aacgaaagtgctgtctatgtgtgctccacaggaactgggaaattttctcttccccaggag
aaaattgtctttaatgcacaaggagatagtgttttaggtgctggtgcctgtggtggtgtt
cctatcattttttctagaaacagtggactggtgtctattacttcaagggaaaatgtgtct
atattggcagaagacttggaagggtctttagcatcttcagttgctggaccaaacagtgag
agtatgatttttgagaccactacaaagaatgaaactatagcccaggaagataaaatcaag
ttgctgaaagctgcctttctgcaatactgcagaaaagatttaggtcatgctcaaatggtg
gttgatgagctcttttcctctcactctgatttggattctgattctgaactagacagggca
gttacccaaatcagtgtagacctgatggatgactacccagcatctgacccacggtgggct
gagtctgtccctgaggaagcacctgggttcagcaatacgtcactgattatccttcaccag
ctagaagacaagatgaaagctcactcttttcttatggactttattcatcaagttggctta
tttggacgtctaggcagttttccagttagagggacaccgatggccactcgactgttgctc
tgtgagcatgccgaaaagctgtcagccgccattgttctcaagaaccaccactcccggctt
tctgaccttgtcaacacagccatattgattgctttgaacaagagggagtatgaaatccca
tccaacctgactcctgcagatgtctttttcagggaggtatcccaagtagataccatctgt
gagtgcttactggagcatgaggagcaagtcttgagggatgcacctatggattccattgaa
tgggctgaagtggtgatcaatgtgaacaatattctcaaggatatgctgcaggctgctagt
cattatcgccaaaatagaaactctttgtatagaagagaagaatcactagaaaaagaacct
gaatatgttccatggacggcaacaagtggtcctggtggcatccgaacggtaataatacgc
cagcatgagattgtcctgaaggtggcttatccacaggcagacagcaacctccgaaacatc
gtgaccgagcagctggtagccctgatcgattgcttcctggatggttatgtttctcagctt
aagtctgtggataaatccagtaatcgggaaagatatgacaatctggagatggaataccta
cagaaaagatcagatctcttatctcctcttctttcactaggccagtacctgtgggctgct
tctctagcagagaaatactgtgactttgatatattggtacaaatgtgtgagcagactgac
aaccagagccgactccagcgctacatgacccagtttgctgatcagaatttttcagacttt
ctcttccgttggtatctggagaaaggaaagcgaggcaaattattatctcagcccatttct
cagcatggacagttggcaaattttttgcaagctcatgaacatctcagctggttacatgaa
attaatagccaagaattagaaaaggctcatgcaacacttctgggtttggcaaatatggaa
actcgttactttgcaaagaagaaaacccttcttggcttgagtaaattggctgcattagct
tcagacttttcagaggatatgctacaagaaaaaattgaagaaatggctgagcaggagcgc
tttctactgcatcaggagaccctacctgaacagctgctggcggagaaacagctaaatctc
agtgcgatgccagtattgactgcaccacaactcattggtctatatatctgtgaagaaaat
agaagagctaatgaatatgatttcaagaaagctttggacttgttggaatatattgatgag
gaagaagatataaatataaatgatctaaaactggaaatcctttgcaaagctcttcagaga
gataactggtccagttctgatggcaaagatgatccaattgaagtatctaaagacagtata
tttgtgaagatcttacagaaacttttaaaagatggcattcagctcagtgagtacttaccg
gaggtgaaagacctgctacaagcggatcagcttggaagcttaaagtccaatccttacttc
gagtttgttttgaaagcaaattatgaatattatgttcagggacaaatataa

DBGET integrated database retrieval system