KEGG   Homo sapiens (human): 5683
Entry
5683              CDS       T01001                                 

Gene name
PSMA2, HC3, MU, PMSA2, PSC2
Definition
(RefSeq) proteasome 20S subunit alpha 2
  KO
K02726  20S proteasome subunit alpha 2 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01197  Scrapie conformation PrPSc to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5683 (PSMA2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5683 (PSMA2)
   05012 Parkinson disease
    5683 (PSMA2)
   05014 Amyotrophic lateral sclerosis
    5683 (PSMA2)
   05016 Huntington disease
    5683 (PSMA2)
   05017 Spinocerebellar ataxia
    5683 (PSMA2)
   05020 Prion disease
    5683 (PSMA2)
   05022 Pathways of neurodegeneration - multiple diseases
    5683 (PSMA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5683 (PSMA2)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5683 (PSMA2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5683 (PSMA2)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   5683 (PSMA2)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    5683 (PSMA2)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 5683
NCBI-ProteinID: NP_002778
OMIM: 176842
HGNC: 9531
Ensembl: ENSG00000106588
Vega: OTTHUMG00000023916
Pharos: P25787(Tbio)
UniProt: P25787 A0A024RA52
LinkDB
Structure
PDB: 

Position
7p14.1
AA seq 234 aa
MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDER
SVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQE
YTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNE
DLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAIA
NT seq 705 nt   +upstreamnt  +downstreamnt
atggcggagcgcgggtacagcttttcgctgactacattcagcccgtctggtaaacttgtc
cagattgaatatgctttggctgctgtagctggaggagccccgtccgtgggaattaaagct
gcaaatggtgtggtattagcaactgagaaaaaacagaaatccattctgtatgatgagcga
agtgtacacaaagtagaaccaattaccaagcatataggtttggtgtacagtggcatgggc
cccgattacagagtgcttgtgcacagagctcgaaaactagctcaacaatactatcttgtg
taccaagaacccattcctacagctcagctggtacagagagtagcttctgtgatgcaagaa
tatactcagtcaggtggtgttcgtccatttggagtttctttacttatttgtggttggaat
gagggacgaccatatttatttcagtcagatccatctggagcttactttgcctggaaagct
acagcaatgggaaagaactatgtgaatgggaagactttccttgagaaaagatataatgaa
gatctggaacttgaagatgccattcatacagccatcttaaccctaaaggaaagctttgaa
gggcaaatgacagaggataacatagaagttggaatctgcaatgaagctggatttaggagg
cttactccaactgaagttaaggattacttggctgccatagcataa

DBGET integrated database retrieval system