KEGG   Homo sapiens (human): 5692
Entry
5692              CDS       T01001                                 

Gene name
PSMB4, HN3, HsN3, PRAAS3, PROS-26, PROS26
Definition
(RefSeq) proteasome 20S subunit beta 4
  KO
K02736  20S proteasome subunit beta 7 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01197  Scrapie conformation PrPSc to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5692 (PSMB4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5692 (PSMB4)
   05012 Parkinson disease
    5692 (PSMB4)
   05014 Amyotrophic lateral sclerosis
    5692 (PSMB4)
   05016 Huntington disease
    5692 (PSMB4)
   05017 Spinocerebellar ataxia
    5692 (PSMB4)
   05020 Prion disease
    5692 (PSMB4)
   05022 Pathways of neurodegeneration - multiple diseases
    5692 (PSMB4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5692 (PSMB4)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5692 (PSMB4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5692 (PSMB4)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   5692 (PSMB4)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    5692 (PSMB4)
SSDB
Motif
Pfam: Proteasome
Other DBs
NCBI-GeneID: 5692
NCBI-ProteinID: NP_002787
OMIM: 602177
HGNC: 9541
Ensembl: ENSG00000159377
Vega: OTTHUMG00000012494
Pharos: P28070(Tbio)
UniProt: P28070 A0A140VK46
LinkDB
Structure
PDB: 

Position
1q21.3
AA seq 264 aa
MEAFLGSRSGLWAGGPAPGQFYRIPSTPDSFMDPASALYRGPITRTQNPMVTGTSVLGVK
FEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEE
LLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAP
SLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEK
GVEIEGPLSTETNWDIAHMISGFE
NT seq 795 nt   +upstreamnt  +downstreamnt
atggaagcgtttttggggtcgcggtccggactttgggcggggggtccggccccaggacag
ttttaccgcattccgtccactcccgattccttcatggatccggcgtctgcactttacaga
ggtccaatcacgcggacccagaaccccatggtgaccgggacctcagtcctcggcgttaag
ttcgagggcggagtggtgattgccgcagacatgctgggatcctacggctccttggctcgt
ttccgcaacatctctcgcattatgcgagtcaacaacagtaccatgctgggtgcctctggc
gactacgctgatttccagtatttgaagcaagttctcggccagatggtgattgatgaggag
cttctgggagatggacacagctatagtcctagagctattcattcatggctgaccagggcc
atgtacagccggcgctcgaagatgaaccctttgtggaacaccatggtcatcggaggctat
gctgatggagagagcttcctcggttatgtggacatgcttggtgtagcctatgaagcccct
tcgctggccactggttatggtgcatacttggctcagcctctgctgcgagaagttctggag
aagcagccagtgctaagccagaccgaggcccgcgacttagtagaacgctgcatgcgagtg
ctgtactaccgagatgcccgttcttacaaccggtttcaaatcgccactgtcaccgaaaaa
ggtgttgaaatagagggaccattgtctacagagaccaactgggatattgcccacatgatc
agtggctttgaatga

DBGET integrated database retrieval system