KEGG   Homo sapiens (human): 5695
Entry
5695              CDS       T01001                                 

Gene name
PSMB7, Z
Definition
(RefSeq) proteasome 20S subunit beta 7
  KO
K02739  20S proteasome subunit beta 2 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01197  Scrapie conformation PrPSc to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5695 (PSMB7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5695 (PSMB7)
   05012 Parkinson disease
    5695 (PSMB7)
   05014 Amyotrophic lateral sclerosis
    5695 (PSMB7)
   05016 Huntington disease
    5695 (PSMB7)
   05017 Spinocerebellar ataxia
    5695 (PSMB7)
   05020 Prion disease
    5695 (PSMB7)
   05022 Pathways of neurodegeneration - multiple diseases
    5695 (PSMB7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5695 (PSMB7)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5695 (PSMB7)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5695 (PSMB7)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   5695 (PSMB7)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    5695 (PSMB7)
SSDB
Motif
Pfam: Proteasome Pr_beta_C
Other DBs
NCBI-GeneID: 5695
NCBI-ProteinID: NP_002790
OMIM: 604030
HGNC: 9544
Ensembl: ENSG00000136930
Vega: OTTHUMG00000021042
Pharos: Q99436(Tbio)
UniProt: Q99436 E9KL30
LinkDB
Structure
PDB: 

Position
9q33.3
AA seq 277 aa
MAAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGAD
TRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVV
TANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAV
FEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGT
RLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS
NT seq 834 nt   +upstreamnt  +downstreamnt
atggcggctgtgtcggtgtatgctccaccagttggaggcttctcttttgataactgccgc
aggaatgccgtcttggaagccgattttgcaaagaggggatacaagcttccaaaggtccgg
aaaactggcacgaccatcgctggggtggtctataaggatggcatagttcttggagcagat
acaagagcaactgaagggatggttgttgctgacaagaactgttcaaaaatacacttcata
tctcctaatatttattgttgtggtgctgggacagctgcagacacagacatgacaacccag
ctcatttcttccaacctggagctccactccctctccactggccgtcttcccagagttgtg
acagccaatcggatgctgaagcagatgcttttcaggtatcaaggttacattggtgcagcc
ctagttttagggggagtagatgttactggacctcacctctacagcatctatcctcatgga
tcaactgataagttgccttatgtcaccatgggttctggctccttggcagcaatggctgta
tttgaagataagtttaggccagacatggaggaggaggaagccaagaatctggtgagcgaa
gccatcgcagctggcatcttcaacgacctgggctccggaagcaacattgacctctgcgtc
atcagcaagaacaagctggattttctccgcccatacacagtgcccaacaagaaggggacc
aggcttggccggtacaggtgtgagaaagggactactgcagtcctcactgagaaaatcact
cctctggagattgaggtgctggaagaaacagtccaaacaatggacacttcctga

DBGET integrated database retrieval system