KEGG   Homo sapiens (human): 5702
Entry
5702              CDS       T01001                                 

Symbol
PSMC3, DCIDP, RPT5, TBP1
Name
(RefSeq) proteasome 26S subunit, ATPase 3
  KO
K03065  26S proteasome regulatory subunit T5
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05169  Epstein-Barr virus infection
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01197  Scrapie conformation PrPSc to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5702 (PSMC3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5702 (PSMC3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5702 (PSMC3)
   05012 Parkinson disease
    5702 (PSMC3)
   05014 Amyotrophic lateral sclerosis
    5702 (PSMC3)
   05016 Huntington disease
    5702 (PSMC3)
   05017 Spinocerebellar ataxia
    5702 (PSMC3)
   05020 Prion disease
    5702 (PSMC3)
   05022 Pathways of neurodegeneration - multiple diseases
    5702 (PSMC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5702 (PSMC3)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     5702 (PSMC3)
SSDB
Motif
Pfam: AAA Prot_ATP_ID_OB AAA_lid_3 AAA_5 AAA_16 RuvB_N AAA_2 AAA_22 AAA_33 DUF815 Mg_chelatase PhoH AAA_11 IstB_IS21 Sigma54_activat DUF5827 ATPase AAA_24 AAA_7 DUF3713 RNA_helicase
Other DBs
NCBI-GeneID: 5702
NCBI-ProteinID: NP_002795
OMIM: 186852
HGNC: 9549
Ensembl: ENSG00000165916
Vega: OTTHUMG00000167692
Pharos: P17980(Tbio)
UniProt: P17980 A0A140VK42
LinkDB
Structure
PDB: 

Position
11p11.2
AA seq 439 aa
MNLLPNIESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIIQRTRLLDSEIKIMKSEVL
RVTHELQAMKDKIKENSEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGK
CAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEVDER
PTEQYSDIGGLDKQIQELVEAIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLARAC
AAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEK
AGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEE
ARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGMIALRRGATELTHEDY
MEGILEVQAKKKANLQYYA
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgaatctgctgccgaatattgagagtccagtgactcggcaggagaagatggcgaccgtg
tgggatgaggccgagcaagatggaattggggaggaggtgctcaagatgtccacggaggag
atcatccagcgcacacggctgctggacagtgagatcaagatcatgaagagtgaagtgttg
agagtcacccatgagctccaagccatgaaggacaagataaaagagaacagtgagaaaatc
aaagtgaacaagaccctgccgtaccttgtctccaacgtcatcgagctcctggatgttgat
cctaatgaccaagaggaggatggtgccaatattgacctggactcccagaggaagggcaag
tgtgctgtgatcaaaacctctacacgacagacgtacttccttcctgtgattgggttggtg
gatgctgaaaagctaaagccaggagacctggtgggtgtgaacaaagactcctatctgatc
ctggagacgctgcccacagagtatgactcgcgggtgaaggccatggaggtagacgagagg
cccacggagcaatacagtgacattgggggtttggacaagcagatccaggagctggtggag
gccattgtcttgccaatgaaccacaaggagaagtttgagaacttggggatccaacctcca
aaaggggtgctgatgtatgggcccccagggacggggaagaccctcctggcccgggcctgt
gccgcacagactaaggccaccttcctaaagctggctggcccccagctggtgcagatgttc
attggagatggtgccaagctagtccgggatgcctttgccctggccaaggagaaagcgccc
tctatcatcttcattgatgagttggatgccatcggcaccaagcgctttgacagtgagaag
gctggggaccgggaggtgcagaggacaatgctggagcttctgaaccagctggatggcttc
cagcccaacacccaagttaaggtaattgcagccacaaacagggtggacatcctggacccc
gccctcctccgctcgggccgccttgaccgcaagatagagttcccgatgcccaatgaggag
gcccgggccagaatcatgcagatccactcccgaaagatgaatgtcagtcctgacgtgaac
tacgaggagctggcccgctgcacagatgacttcaatggggcccagtgcaaggctgtgtgt
gtggaggcgggcatgatcgcactgcgcaggggtgccacggagctcacccacgaggactac
atggaaggcatcctggaggtgcaggccaagaagaaagccaacctacaatactacgcctag

DBGET integrated database retrieval system