KEGG   Homo sapiens (human): 5704
Entry
5704              CDS       T01001                                 

Symbol
PSMC4, MIP224, RPT3, S6, TBP-7, TBP7
Name
(RefSeq) proteasome 26S subunit, ATPase 4
  KO
K03063  26S proteasome regulatory subunit T3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05169  Epstein-Barr virus infection
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01197  Scrapie conformation PrPSc to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5704 (PSMC4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5704 (PSMC4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5704 (PSMC4)
   05012 Parkinson disease
    5704 (PSMC4)
   05014 Amyotrophic lateral sclerosis
    5704 (PSMC4)
   05016 Huntington disease
    5704 (PSMC4)
   05017 Spinocerebellar ataxia
    5704 (PSMC4)
   05020 Prion disease
    5704 (PSMC4)
   05022 Pathways of neurodegeneration - multiple diseases
    5704 (PSMC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5704 (PSMC4)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     5704 (PSMC4)
SSDB
Motif
Pfam: AAA Prot_ATP_ID_OB AAA_lid_3 AAA_2 AAA_5 AAA_16 RuvB_N DUF815 AAA_22 RNA_helicase AAA_14 Mg_chelatase NTPase_1 AAA_28 AAA_18 IstB_IS21 AAA_33 Sigma54_activat NACHT TIP49 CENP-F_leu_zip AAA_3 ATPase_2 TsaE AAA_7 AAA_24 AAA_17 AAA_25 Zeta_toxin DUF3450 NB-ARC DivIVA Parvo_NS1 ABC_tran
Other DBs
NCBI-GeneID: 5704
NCBI-ProteinID: NP_006494
OMIM: 602707
HGNC: 9551
Ensembl: ENSG00000013275
Vega: OTTHUMG00000182577
Pharos: P43686(Tbio)
UniProt: P43686 A8K2M0
LinkDB
Structure
PDB: 

Position
19q13.2
AA seq 418 aa
MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEY
IKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTID
RELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREA
VELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYL
GEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFD
QNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDL
EDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggaggagataggcatcttggtggagaaggctcaggatgagatcccagcactgtccgtg
tcccggccccagaccggcctgtccttcctgggccctgagcctgaggacctggaggacctg
tacagccgctacaagaagctgcagcaagagctggagttcctggaggtgcaggaggaatac
atcaaagatgagcaaaagaacctgaaaaaggaatttctccatgcccaggaggaggtgaag
cgaatccaaagcatcccgctggtcatcggacaatttctggaggctgtggatcagaataca
gccatcgtgggctctaccacaggctccaactattatgtgcgcatcctgagcaccatcgat
cgggagctgctcaagcccaacgcctcagtggccctccacaagcacagcaatgcactggtg
gacgtgctgccccccgaagccgacagcagcatcatgatgctcacctcagaccagaagcca
gatgtgatgtacgcggacatcggaggcatggacatccagaagcaggaggtgcgggaggcc
gtggagctcccgctcacgcatttcgagctctacaagcagatcggcatcgatcccccccga
ggcgtcctcatgtatggcccacctggctgtgggaagaccatgttggcaaaggcggtggca
catcacacaacagctgcattcatccgggtcgtgggctcggagtttgtacagaagtatctg
ggtgagggcccccgcatggtccgggatgtgttccgcctggccaaggagaatgcacctgcc
atcatcttcatagacgagattgatgccatcgccaccaagagattcgatgctcagacaggg
gccgacagggaggttcagaggatcctgctggagctgctgaatcagatggatggatttgat
cagaatgtcaatgtcaaggtaatcatggccacaaacagagcagacaccctggatccggcc
ctgctacggccaggacggctggaccgtaaaattgaatttccacttcctgaccgccgccag
aagagattgattttctccactatcactagcaagatgaacctctctgaggaggttgacttg
gaagactatgtggcccggccagataagatttcaggagctgatattaactccatctgtcag
gagagtggaatgttggctgtccgtgaaaaccgctacattgtcctggccaaggacttcgag
aaagcatacaagactgtcatcaagaaggacgagcaggagcatgagttttacaagtga

DBGET integrated database retrieval system