KEGG   Homo sapiens (human): 57122
Entry
57122             CDS       T01001                                 
Symbol
NUP107, NPHS11, NUP84, ODG6, GAMOS7
Name
(RefSeq) nucleoporin 107
  KO
K14301  nuclear pore complex protein Nup107
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  Nucleocytoplasmic transport
hsa05014  Amyotrophic lateral sclerosis
Network
nt06424  RNA processing
nt06464  Amyotrophic lateral sclerosis
  Element
N01152  Nuclear export of mRNA
N01153  Mutation-caused aberrant GLE1 to nuclear export of mRNA
Disease
H00599  Ovarian dysgenesis
H01657  Nephrotic syndrome
H01722  Galloway-Mowat syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    57122 (NUP107)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    57122 (NUP107)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    57122 (NUP107)
   03036 Chromosome and associated proteins [BR:hsa03036]
    57122 (NUP107)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     57122 (NUP107)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Spindle formation proteins
    57122 (NUP107)
SSDB
Motif
Pfam: Nup84_Nup100
Other DBs
NCBI-GeneID: 57122
NCBI-ProteinID: NP_065134
OMIM: 607617
HGNC: 29914
Ensembl: ENSG00000111581
Vega: OTTHUMG00000169265
Pharos: P57740(Tbio)
UniProt: P57740
Structure
LinkDB
Position
12:68686978..68745809
AA seq 925 aa
MDRSGFGEISSPVIREAEVTRTARKQSAQKRVLLQASQDENFGNTTPRNQVIPRTPSSFR
QPFTPTSRSLLRQPDISCILGTGGKSPRLTQSSGFFGNLSMVTNLDDSNWAAAFSSQRSG
LFTNTEPHSITEDVTISAVMLREDDPGEAASMSMFSDFLQSFLKHSSSTVFDLVEEYENI
CGSQVNILSKIVSRATPGLQKFSKTASMLWLLQQEMVTWRLLASLYRDRIQSALEEESVF
AVTAVNASEKTVVEALFQRDSLVRQSQLVVDWLESIAKDEIGEFSDNIEFYAKSVYWENT
LHTLKQRQLTSYVGSVRPLVTELDPDAPIRQKMPLDDLDREDEVRLLKYLFTLIRAGMTE
EAQRLCKRCGQAWRAATLEGWKLYHDPNVNGGTELEPVEGNPYRRIWKISCWRMAEDELF
NRYERAIYAALSGNLKQLLPVCDTWEDTVWAYFRVMVDSLVEQEIQTSVATLDETEELPR
EYLGANWTLEKVFEELQATDKKRVLEENQEHYHIVQKFLILGDIDGLMDEFSKWLSKSRN
NLPGHLLRFMTHLILFFRTLGLQTKEEVSIEVLKTYIQLLIREKHTNLIAFYTCHLPQDL
AVAQYALFLESVTEFEQRHHCLELAKEADLDVATITKTVVENIRKKDNGEFSHHDLAPAL
DTGTTEEDRLKIDVIDWLVFDPAQRAEALKQGNAIMRKFLASKKHEAAKEVFVKIPQDSI
AEIYNQCEEQGMESPLPAEDDNAIREHLCIRAYLEAHETFNEWFKHMNSVPQKPALIPQP
TFTEKVAHEHKEKKYEMDFGIWKGHLDALTADVKEKMYNVLLFVDGGWMVDVREDAKEDH
ERTHQMVLLRKLCLPMLCFLLHTILHSTGQYQECLQLADMVSSERHKLYLVFSKEELRKL
LQKLRESSLMLLDQGLDPLGYEIQL
NT seq 2778 nt   +upstreamnt  +downstreamnt
atggacaggagtggctttggagagatatcatcccctgtaatccgggaggcagaggtgaca
cggactgcacggaaacagagtgctcagaaaagagttttacttcaggcatctcaagatgaa
aattttggtaatactacaccaagaaaccaggttatccctcgaactcctagctcatttcga
cagccttttaccccaacaagccgaagcttactaaggcagccagatatttcctgcattctt
ggaacaggagggaagtcgccccgacttacgcagtcttcagggttctttggaaatctctcc
atggttactaatctggatgacagtaactgggcagctgcattttcatcacagcgttccggg
ctgttcacaaacacagagccccacagtataacagaagatgtaactatcagtgctgttatg
ttacgtgaggatgatcctggagaagctgcatccatgagtatgttttctgatttcctgcag
tcttttctgaagcactcttcgagtacagtttttgatcttgtggaagagtatgaaaacatc
tgtggtagtcaggtgaatatactgagtaaaatagtgagtcgagcaacacctggacttcaa
aaattttcaaaaacagccagtatgctctggcttcttcaacaggagatggtcacatggagg
ctgctggcttctttgtatagagacagaatacagtctgcattagaagaggaaagtgtattc
gcagttactgctgttaatgccagtgaaaaaacagttgtggaagcgttatttcagagggat
tcacttgttcgacaaagtcagctggtggtagattggttagagagtattgccaaagatgaa
attggagaattttctgataatattgagttttatgcaaaatcagtatattgggaaaatact
ctgcataccttaaaacaacggcagctgacttcttacgttggaagtgttcgtccgcttgtc
actgaattggaccctgatgctcccataagacagaaaatgccccttgatgatctggataga
gaagatgaagttagattactcaaatatctctttactctaatccgtgctggaatgacagaa
gaggcacaacgactctgtaaacgctgtggtcaagcatggagagctgcaacacttgaaggc
tggaaactgtaccatgaccctaatgttaatggaggaacagaattagaacctgttgaaggg
aatccatatagacgcatttggaaaataagttgctggagaatggcagaagatgagcttttt
aatagatacgagagagcaatttatgcagctttaagtgggaatcttaagcagctgcttcct
gtctgtgacacctgggaagacacagtttgggcctacttccgggtgatggtggacagtctg
gtagaacaggagatccagacatcagtagcaactctggatgaaactgaagaactccctaga
gaatatctgggagcaaactggacgttagaaaaggtttttgaggaacttcaagctactgac
aaaaagagagttctggaagagaatcaagaacattatcatatagttcaaaagtttcttatc
ctgggagacattgatggtttgatggatgagtttagcaaatggctttccaaaagcagaaac
aatctacctggacacctgcttcgctttatgactcaccttattttgtttttccgtactctg
ggactacagaccaaggaggaagtttctattgaagttttaaagacatacatacagctttta
ataagagagaaacatacaaatcttatagcattttatacctgtcatttgcctcaagaccta
gctgttgcccagtatgcattatttttggaaagtgttacagaatttgaacagcgccaccat
tgcctggagttggctaaagaagcagatttggatgttgcaacaataacaaaaactgtagtt
gagaatattcgaaagaaagataatggtgaatttagtcatcatgacctggccccagcccta
gatactggcactactgaggaggatcgtttaaaaattgatgtaattgactggttggtattt
gacccagcgcagagggcagaagcactgaaacaaggcaatgcaattatgagaaaattcttg
gcatcaaaaaagcacgaagctgcaaaagaagtatttgtgaaaattcctcaggattctata
gcagaaatctataatcagtgcgaggaacaaggaatggaaagtccacttcctgctgaagat
gataatgctatccgagaacatttgtgcatcagagcttatttggaagcccatgaaaccttt
aatgagtggtttaagcatatgaattcagttccacaaaaacctgctttgatacctcaacca
acttttactgagaaagtggctcatgaacacaaagaaaagaaatatgaaatggattttggt
atttggaaagggcatttggatgccctaactgctgatgtgaaggagaaaatgtataacgtc
ttgttgtttgttgatggagggtggatggtggatgttagagaggatgccaaagaagaccat
gaaagaacacatcaaatggtcttactgagaaagctttgtctgccaatgttgtgttttctg
cttcatacgatattgcacagtactggtcagtatcaggaatgcctacagttagcagatatg
gtatcctctgagcgccacaaactgtacctggtattttctaaggaagagctaaggaagttg
ctgcagaagctcagagagtcctctctaatgctcctagaccagggacttgacccattaggg
tatgaaattcagttatag

DBGET integrated database retrieval system