Homo sapiens (human): 5868 Help Entry 5868              CDS       T01001                                  Symbol RAB5A, RAB5 Name (RefSeq) RAB5A, member RAS oncogene family   KO K07887   Ras-related protein Rab-5A Organism hsa  Homo sapiens (human) Pathway hsa04014   Ras signaling pathway hsa04137   Mitophagy - animal hsa04144   Endocytosis hsa04145   Phagosome hsa04148   Efferocytosis hsa04962   Vasopressin-regulated water reabsorption hsa05014   Amyotrophic lateral sclerosis hsa05022   Pathways of neurodegeneration - multiple diseases hsa05132   Salmonella infection hsa05146   Amoebiasis hsa05152   Tuberculosis Network nt06181  Salmonella nt06536  Mitophagy   Element N01302   Early endosomal fusion N01303   Salmonella SopB to Early endosomal fusion N01760   Endosomal Rab cycles Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     5868 (RAB5A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     5868 (RAB5A)    04145 Phagosome     5868 (RAB5A)    04137 Mitophagy - animal     5868 (RAB5A)    04148 Efferocytosis     5868 (RAB5A)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     5868 (RAB5A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     5868 (RAB5A)    05152 Tuberculosis     5868 (RAB5A)   09174 Infectious disease: parasitic    05146 Amoebiasis     5868 (RAB5A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     5868 (RAB5A)    05022 Pathways of neurodegeneration - multiple diseases     5868 (RAB5A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hsa04131]     5868 (RAB5A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsa04147]     5868 (RAB5A)    04031 GTP-binding proteins [BR:hsa04031]     5868 (RAB5A) Membrane trafficking [BR:hsa04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     5868 (RAB5A)  Endosome - Lysosome transport     5868 (RAB5A) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    5868 (RAB5A)   Exosomal proteins of other body fluids (saliva and urine)    5868 (RAB5A)   Exosomal proteins of colorectal cancer cells    5868 (RAB5A)   Exosomal proteins of bladder cancer cells    5868 (RAB5A) GTP-binding proteins [BR:hsa04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     5868 (RAB5A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 MCR_beta BrnT_toxin Motif Other DBs NCBI-GeneID:  5868 NCBI-ProteinID:  NP_004153 OMIM:  179512 HGNC:  9783 Ensembl:  ENSG00000144566 UniProt:  P20339 Structure PDBPDBj LinkDB All DBs Position 3:19947097..19985175 Genome browser AA seq 215 aa AA seqDB search MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctagtcgaggcgcaacaagacccaacgggccaaatacgggaaataaaatatgccag ttcaaactagtacttctgggagagtccgctgttggcaaatcaagcctagtgcttcgtttt gtgaaaggccaatttcatgaatttcaagagagtaccattggggctgcttttctaacccaa actgtatgtcttgatgacactacagtaaagtttgaaatatgggatacagctggtcaagaa cgataccatagcctagcaccaatgtactacagaggagcacaagcagccatagttgtatat gatatcacaaatgaggagtcctttgcaagagcaaaaaattgggttaaagaacttcagagg caagcaagtcctaacattgtaatagctttatcgggaaacaaggccgacctagcaaataaa agagcagtagatttccaggaagcacagtcctatgcagatgacaatagtttattattcatg gagacatccgctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaaa ttgccaaagaatgaaccacaaaatccaggagcaaattctgccagaggaagaggagtagac cttaccgaacccacacaaccaaccaggaatcagtgttgtagtaactaa

Homo sapiens (human): 5869 Help Entry 5869              CDS       T01001                                  Symbol RAB5B Name (RefSeq) RAB5B, member RAS oncogene family   KO K07888   Ras-related protein Rab-5B Organism hsa  Homo sapiens (human) Pathway hsa04014   Ras signaling pathway hsa04137   Mitophagy - animal hsa04144   Endocytosis hsa04145   Phagosome hsa04148   Efferocytosis hsa04962   Vasopressin-regulated water reabsorption hsa05132   Salmonella infection hsa05146   Amoebiasis hsa05152   Tuberculosis Network nt06181  Salmonella nt06536  Mitophagy   Element N01302   Early endosomal fusion N01303   Salmonella SopB to Early endosomal fusion N01760   Endosomal Rab cycles Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     5869 (RAB5B)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     5869 (RAB5B)    04145 Phagosome     5869 (RAB5B)    04137 Mitophagy - animal     5869 (RAB5B)    04148 Efferocytosis     5869 (RAB5B)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     5869 (RAB5B)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     5869 (RAB5B)    05152 Tuberculosis     5869 (RAB5B)   09174 Infectious disease: parasitic    05146 Amoebiasis     5869 (RAB5B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hsa04131]     5869 (RAB5B)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsa04147]     5869 (RAB5B)    04031 GTP-binding proteins [BR:hsa04031]     5869 (RAB5B) Membrane trafficking [BR:hsa04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     5869 (RAB5B)  Endosome - Lysosome transport     5869 (RAB5B) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    5869 (RAB5B)   Exosomal proteins of other body fluids (saliva and urine)    5869 (RAB5B)   Exosomal proteins of colorectal cancer cells    5869 (RAB5B)   Exosomal proteins of melanoma cells    5869 (RAB5B) GTP-binding proteins [BR:hsa04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     5869 (RAB5B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  5869 NCBI-ProteinID:  NP_001238965 OMIM:  179514 HGNC:  9784 Ensembl:  ENSG00000111540 UniProt:  P61020 Structure PDBPDBj LinkDB All DBs Position 12:55973949..55996683 Genome browser AA seq 215 aa AA seqDB search MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK LPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgactagcagaagcacagctaggcccaatgggcaaccccaggccagcaaaatttgccag ttcaaattggtcctgctgggagaatctgcagtgggaaagtcaagcctggtattacgtttt gtcaaagggcagttccatgagtaccaggagagcaccattggagcggccttcctcacccag tccgtttgtctagatgacacaacagtgaagtttgagatctgggacacagctgggcaggag cgatatcacagcttagcccccatgtactacaggggtgcccaagctgcaatcgtggtttac gacattactaatcaggaaacctttgcccgagcaaagacatgggtgaaggaactacagcga caggccagtcctagcatcgttattgccctggcagggaacaaagctgacctggccaacaaa cgtatggtggagtatgaagaggcccaggcatatgcagatgacaacagcttattgttcatg gagacttcagccaagacagctatgaacgtgaatgatctcttcctggcaatagctaagaag ttgccaaagagtgaaccccagaatctgggaggtgcagcaggccgaagccggggtgtggat ctccatgaacagtcccagcagaacaagagccagtgttgtagcaactga

Homo sapiens (human): 5878 Help Entry 5878              CDS       T01001                                  Symbol RAB5C, L1880, RAB5CL, RAB5L, RABL Name (RefSeq) RAB5C, member RAS oncogene family   KO K07889   Ras-related protein Rab-5C Organism hsa  Homo sapiens (human) Pathway hsa04014   Ras signaling pathway hsa04137   Mitophagy - animal hsa04144   Endocytosis hsa04145   Phagosome hsa04148   Efferocytosis hsa04962   Vasopressin-regulated water reabsorption hsa05132   Salmonella infection hsa05146   Amoebiasis hsa05152   Tuberculosis Network nt06181  Salmonella nt06536  Mitophagy   Element N01302   Early endosomal fusion N01303   Salmonella SopB to Early endosomal fusion N01760   Endosomal Rab cycles Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     5878 (RAB5C)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     5878 (RAB5C)    04145 Phagosome     5878 (RAB5C)    04137 Mitophagy - animal     5878 (RAB5C)    04148 Efferocytosis     5878 (RAB5C)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     5878 (RAB5C)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     5878 (RAB5C)    05152 Tuberculosis     5878 (RAB5C)   09174 Infectious disease: parasitic    05146 Amoebiasis     5878 (RAB5C)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hsa04131]     5878 (RAB5C)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsa04147]     5878 (RAB5C)    04031 GTP-binding proteins [BR:hsa04031]     5878 (RAB5C) Membrane trafficking [BR:hsa04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     5878 (RAB5C)  Endosome - Lysosome transport     5878 (RAB5C) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    5878 (RAB5C)   Exosomal proteins of other body fluids (saliva and urine)    5878 (RAB5C)   Exosomal proteins of colorectal cancer cells    5878 (RAB5C)   Exosomal proteins of bladder cancer cells    5878 (RAB5C) GTP-binding proteins [BR:hsa04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     5878 (RAB5C) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  5878 NCBI-ProteinID:  NP_004574 OMIM:  604037 HGNC:  9785 Ensembl:  ENSG00000108774 UniProt:  P51148 Structure PDBPDBj LinkDB All DBs Position 17:complement(42124979..42154989) Genome browser AA seq 216 aa AA seqDB search MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ RQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAK KLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atggcgggtcggggaggcgcagcacgacccaatggaccagctgctgggaacaagatctgt caatttaagctggttctgctgggggagtctgcggtaggcaaatccagcctcgtcctccgc tttgtcaagggacagtttcacgagtaccaggagagcacaattggagcggccttcctcaca cagactgtctgcctggatgacacaacagtcaagtttgagatctgggacacagctggacag gagcggtatcacagcctggcccccatgtactatcggggggcccaggctgccatcgtggtc tatgacatcaccaacacagatacatttgcacgggccaagaactgggtgaaggagctacag aggcaggccagccccaacatcgtcattgcactcgcgggtaacaaggcagacctggccagc aagagagccgtggaattccaggaagcacaagcctatgcagacgacaacagtttgctgttc atggagacatcagcaaagactgcaatgaacgtgaacgaaatcttcatggcaatagctaag aagcttcccaagaacgagccccagaatgcaactggtgctccaggccgaaaccgaggtgtg gacctccaggagaacaacccagccagccggagccagtgctgcagcaactga

DBGET integrated database retrieval system