KEGG   Homo sapiens (human): 5889
Entry
5889              CDS       T01001                                 
Symbol
RAD51C, BROVCA3, FANCO, R51H3, RAD51L2
Name
(RefSeq) RAD51 paralog C
  KO
K10870  RAD51-like protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03440  Homologous recombination
hsa03460  Fanconi anemia pathway
Disease
H00238  Fanconi anemia
H02531  Familial breast-ovarian cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    5889 (RAD51C)
   03460 Fanconi anemia pathway
    5889 (RAD51C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5889 (RAD51C)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecA family proteins
     5889 (RAD51C)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     5889 (RAD51C)
SSDB
Motif
Pfam: Rad51 AAA_25 ATPase RecA HHH_5 AAA_18 AAA AAA_24 AAA_33 DnaB_C
Other DBs
NCBI-GeneID: 5889
NCBI-ProteinID: NP_478123
OMIM: 602774
HGNC: 9820
Ensembl: ENSG00000108384
Vega: OTTHUMG00000141292
Pharos: O43502(Tbio)
UniProt: O43502
LinkDB
Position
17:58692573..58735611
AA seq 376 aa
MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALET
LQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKT
TEICGAPGVGKTQLCMQLAVDVQIPECFGGVAGEAVFIDTEGSFMVDRVVDLATACIQHL
QLIAEKHKGEEHRKALEDFTLDNILSHIYYFRCRDYTELLAQVYLLPDFLSEHSKVRLVI
VDGIAFPFRHDLDDLSLRTRLLNGLAQQMISLANNHRLAVILTNQMTTKIDRNQALLVPA
LGESWGHAATIRLIFHWDRKQRLATLYKSPSQKECTVLFQIKPQGFRDTVVTSACSLQTE
GSLSTRKRSRDPEEEL
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgcgcgggaagacgttccgctttgaaatgcagcgggatttggtgagtttcccgctgtct
ccagcggtgcgggtgaagctggtgtctgcggggttccagactgctgaggaactcctagag
gtgaaaccctccgagcttagcaaagaagttgggatatctaaagcagaagccttagaaact
ctgcaaattatcagaagagaatgtctcacaaataaaccaagatatgctggtacatctgag
tcacacaagaagtgtacagcactggaacttcttgagcaggagcatacccagggcttcata
atcaccttctgttcagcactagatgatattcttgggggtggagtgcccttaatgaaaaca
acagaaatttgtggtgcaccaggtgttggaaaaacacaattatgtatgcagttggcagta
gatgtgcagataccagaatgttttggaggagtggcaggtgaagcagtttttattgataca
gagggaagttttatggttgatagagtggtagaccttgctactgcctgcattcagcacctt
cagcttatagcagaaaaacacaagggagaggaacaccgaaaagctttggaggatttcact
cttgataatattctttctcatatttattattttcgctgtcgtgactacacagagttactg
gcacaagtttatcttcttccagatttcctttcagaacactcaaaggttcgactagtgata
gtggatggtattgcttttccatttcgtcatgacctagatgacctgtctcttcgtactcgg
ttattaaatggcctagcccagcaaatgatcagccttgcaaataatcacagattagctgta
attttaaccaatcagatgacaacaaagattgatagaaatcaggccttgcttgttcctgca
ttaggggaaagttggggacatgctgctacaatacggctaatctttcattgggaccgaaag
caaaggttggcaacattgtacaagtcacccagccagaaggaatgcacagtactgtttcaa
atcaaacctcagggatttagagatactgttgttacttctgcatgttcattgcaaacagaa
ggttccttgagcacccggaaacggtcacgagacccagaggaagaattataa

DBGET integrated database retrieval system