KEGG   Homo sapiens (human): 6996
Entry
6996              CDS       T01001                                 
Symbol
TDG, hTDG
Name
(RefSeq) thymine DNA glycosylase
  KO
K20813  thymine-DNA glycosylase [EC:3.2.2.29]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03410  Base excision repair
Network
nt06504  Base excision repair
  Element
N01433  Base excision and strand cleavage by monofunctional glycosylase
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    6996 (TDG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    6996 (TDG)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.29  thymine-DNA glycosylase
     6996 (TDG)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     6996 (TDG)
SSDB
Motif
Pfam: UDG Pox_Ag35
Other DBs
NCBI-GeneID: 6996
NCBI-ProteinID: NP_003202
OMIM: 601423
HGNC: 11700
Ensembl: ENSG00000139372
Pharos: Q13569(Tbio)
UniProt: Q13569 B4E127
Structure
LinkDB
Position
12:103965872..103988874
AA seq 410 aa
MEAENAGSYSLQQAQAFYTFPFQQLMAEAPNMAVVNEQQMPEEVPAPAPAQEPVQEAPKG
RKRKPRTTEPKQPVEPKKPVESKKSGKSAKSKEKQEKITDTFKVKRKVDRFNGVSEAELL
TKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHT
LPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSK
EVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLK
GIERNMDVQEVQYTFDLQLAQEDAKKMAVKEEKYDPGYEAAYGGAYGENPCSSEPCGFSS
NGLIESVELRGESAFSGIPNGQWMTQSFTDQIPSFSNHCGTQEQEEESHA
NT seq 1233 nt   +upstreamnt  +downstreamnt
atggaagcggagaacgcgggcagctattcccttcagcaagctcaagctttttatacgttt
ccatttcaacaactgatggctgaagctcctaatatggcagttgtgaatgaacagcaaatg
ccagaagaagttccagccccagctcctgctcaggaaccagtgcaagaggctccaaaagga
agaaaaagaaaacccagaacaacagaaccaaaacaaccagtggaacccaaaaaacctgtt
gagtcaaaaaaatctggcaagtctgcaaaatcaaaagaaaaacaagaaaaaattacagac
acatttaaagtaaaaagaaaagtagaccgttttaatggtgtttcagaagctgaacttctg
accaagactctccccgatattttgaccttcaatctggacattgtcattattggcataaac
ccgggactaatggctgcttacaaagggcatcattaccctggacctggaaaccatttttgg
aagtgtttgtttatgtcagggctcagtgaggtccagctgaaccatatggatgatcacact
ctaccagggaagtatggtattggatttaccaacatggtggaaaggaccacgcccggcagc
aaagatctctccagtaaagaatttcgtgaaggaggacgtattctagtacagaaattacag
aaatatcagccacgaatagcagtgtttaatggaaaatgtatttatgaaatttttagtaaa
gaagtttttggagtaaaggttaagaacttggaatttgggcttcagccccataagattcca
gacacagaaactctctgctatgttatgccatcatccagtgcaagatgtgctcagtttcct
cgagcccaagacaaagttcattactacataaaactgaaggacttaagagatcagttgaaa
ggcattgaacgaaatatggacgttcaagaggtgcaatatacatttgacctacagcttgcc
caagaggatgcaaagaagatggctgttaaggaagaaaaatatgatccaggttatgaggca
gcatatggtggtgcttacggagaaaatccatgcagcagtgaaccttgtggcttctcttca
aatgggctaattgagagcgtggagttaagaggagaatcagctttcagtggcattcctaat
gggcagtggatgacccagtcatttacagaccaaattccttcctttagtaatcactgtgga
acacaagaacaggaagaagaaagccatgcttaa

DBGET integrated database retrieval system