KEGG   Homo sapiens (human): 7035
Entry
7035              CDS       T01001                                 

Gene name
TFPI, EPI, LACI, TFI, TFPI1
Definition
(RefSeq) tissue factor pathway inhibitor
  KO
K03909  tissue factor pathway inhibitor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
Drug target
Concizumab: D11847
Marstacimab: D11261
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    7035 (TFPI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    7035 (TFPI)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7035 (TFPI)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I2: Kunitz - BPTI family
   7035 (TFPI)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   7035 (TFPI)
SSDB
Motif
Pfam: Kunitz_BPTI
Other DBs
NCBI-GeneID: 7035
NCBI-ProteinID: NP_001316168
OMIM: 152310
HGNC: 11760
Ensembl: ENSG00000003436
Vega: OTTHUMG00000132634
Pharos: P10646(Tbio)
UniProt: P10646
LinkDB
Structure
PDB: 

Position
2q32.1
AA seq 304 aa
MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADD
GPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQE
KPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPN
GFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIG
KCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIF
VKNM
NT seq 915 nt   +upstreamnt  +downstreamnt
atgatttacacaatgaagaaagtacatgcactttgggcttctgtatgcctgctgcttaat
cttgcccctgcccctcttaatgctgattctgaggaagatgaagaacacacaattatcaca
gatacggagttgccaccactgaaacttatgcattcattttgtgcattcaaggcggatgat
ggcccatgtaaagcaatcatgaaaagatttttcttcaatattttcactcgacagtgcgaa
gaatttatatatgggggatgtgaaggaaatcagaatcgatttgaaagtctggaagagtgc
aaaaaaatgtgtacaagagataatgcaaacaggattataaagacaacattgcaacaagaa
aagccagatttctgctttttggaagaagatcctggaatatgtcgaggttatattaccagg
tatttttataacaatcagacaaaacagtgtgaacgtttcaagtatggtggatgcctgggc
aatatgaacaattttgagacactggaagaatgcaagaacatttgtgaagatggtccgaat
ggtttccaggtggataattatggaacccagctcaatgctgtgaataactccctgactccg
caatcaaccaaggttcccagcctttttgaatttcacggtccctcatggtgtctcactcca
gcagacagaggattgtgtcgtgccaatgagaacagattctactacaattcagtcattggg
aaatgccgcccatttaagtacagtggatgtgggggaaatgaaaacaattttacttccaaa
caagaatgtctgagggcatgtaaaaaaggtttcatccaaagaatatcaaaaggaggccta
attaaaaccaaaagaaaaagaaagaagcagagagtgaaaatagcatatgaagaaattttt
gttaaaaatatgtga

DBGET integrated database retrieval system