KEGG   Homo sapiens (human): 729991
Entry
729991            CDS       T01001                                 

Gene name
BORCS8, MEF2BNB
Definition
(RefSeq) BLOC-1 related complex subunit 8
  KO
K20822  BLOC-1 related complex subunit 8
Organism
hsa  Homo sapiens (human)
Network
nt06125  Membrane trafficking (bacteria)
  Element
N01297  Arl8-regulated microtubule plus-end directed transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    729991 (BORCS8)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Arf GTPases and associated proteins
   BLOC-one-related complex (BORC)
    729991 (BORCS8)
SSDB
Motif
Pfam: BORCS8 Serine_rich
Other DBs
NCBI-GeneID: 729991
NCBI-ProteinID: NP_001139256
OMIM: 616601
HGNC: 37247
Ensembl: ENSG00000254901
Vega: OTTHUMG00000166546
Pharos: Q96FH0(Tdark)
UniProt: Q96FH0
LinkDB
Position
19p13.11
AA seq 119 aa
MEEPEMQLKGKKVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQS
QGAIYTVEYACSAVKNLVDSSVYFRSVEGLLKQAISIRDHMNASAQGHSPEEPPPPSSA
NT seq 360 nt   +upstreamnt  +downstreamnt
atggaggagccggagatgcagctcaaggggaagaaagtcacggacaagttcactgagagc
gtctacgtcctggccaacgagccatccgtggccctgtaccggctgcaggagcatgtgcgt
cgctccctccccgagctggcccagcacaaggcagacatgcagcgttgggaggagcagagc
cagggagccatctacactgtggagtacgcctgcagcgccgtgaagaacctggtggacagc
agcgtctacttccgcagcgtggagggtctgctcaaacaggccatcagcatccgggaccat
atgaatgccagtgcccagggccacagcccggaggaaccacccccgccctcctcagcctga

DBGET integrated database retrieval system