Homo sapiens (human): 729991 Help Entry 729991            CDS       T01001                                  Symbol BORCS8, MEF2BNB, NDOABA Name (RefSeq) BLOC-1 related complex subunit 8   KO K20822   BLOC-1 related complex subunit 8 Organism hsa  Homo sapiens (human) Network nt06181  Salmonella   Element N01297   Arl8-regulated microtubule plus-end directed transport Disease H02839   Infantile-onset neurodegeneration with optic atrophy and brain abnormalities Brite KEGG Orthology (KO) [BR:hsa00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hsa04131]     729991 (BORCS8) Membrane trafficking [BR:hsa04131]  Endosome - Lysosome transport   Arf GTPases and associated proteins    BLOC-one-related complex (BORC)     729991 (BORCS8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  BORCS8 Serine_rich Motif Other DBs NCBI-GeneID:  729991 NCBI-ProteinID:  NP_001139256 OMIM:  616601 HGNC:  37247 Ensembl:  ENSG00000254901 UniProt:  Q96FH0 LinkDB All DBs Position 19:complement(19176906..19192152) Genome browser AA seq 119 aa AA seqDB search MEEPEMQLKGKKVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQS QGAIYTVEYACSAVKNLVDSSVYFRSVEGLLKQAISIRDHMNASAQGHSPEEPPPPSSA NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggaggagccggagatgcagctcaaggggaagaaagtcacggacaagttcactgagagc gtctacgtcctggccaacgagccatccgtggccctgtaccggctgcaggagcatgtgcgt cgctccctccccgagctggcccagcacaaggcagacatgcagcgttgggaggagcagagc cagggagccatctacactgtggagtacgcctgcagcgccgtgaagaacctggtggacagc agcgtctacttccgcagcgtggagggtctgctcaaacaggccatcagcatccgggaccat atgaatgccagtgcccagggccacagcccggaggaaccacccccgccctcctcagcctga

DBGET integrated database retrieval system