KEGG   Homo sapiens (human): 7516
Entry
7516              CDS       T01001                                 
Symbol
XRCC2, FANCU, POF17, SPGF50
Name
(RefSeq) X-ray repair cross complementing 2
  KO
K10879  DNA-repair protein XRCC2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03440  Homologous recombination
Disease
H00238  Fanconi anemia
H00627  Premature ovarian failure
H01282  Spermatogenic failure
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    7516 (XRCC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    7516 (XRCC2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecA family proteins
     7516 (XRCC2)
SSDB
Motif
Pfam: Rad51 AAA_25 RecA
Other DBs
NCBI-GeneID: 7516
NCBI-ProteinID: NP_005422
OMIM: 600375
HGNC: 12829
Ensembl: ENSG00000196584
Pharos: O43543(Tbio)
UniProt: O43543 A0A384MEK2
LinkDB
Position
7:complement(152644776..152676141)
AA seq 280 aa
MCSAFHRAESGTELLARLEGRSSLKEIEPNLFADEDSPVHGDILEFHGPEGTGKTEMLYH
LTARCILPKSEGGLEVEVLFIDTDYHFDMLRLVTILEHRLSQSSEEIIKYCLGRFFLVYC
SSSTHLLLTLYSLESMFCSHPSLCLLILDSLSAFYWIDRVNGGESVNLQESTLRKCSQCL
EKLVNDYRLVLFATTQTIMQKASSSSEEPSHASRRLCDVDIDYRPYLCKAWQQLVKHRMF
FSKQDDSQSSNQFSLVSRCLKSNSLKKHFFIIGESGVEFC
NT seq 843 nt   +upstreamnt  +downstreamnt
atgtgtagtgccttccatagggctgagtctgggaccgagctccttgcccgacttgaaggt
agaagttccttgaaagaaatagaaccaaatctgtttgctgatgaagattcacctgtgcat
ggtgatattcttgaatttcatggcccagaaggaacaggaaaaacagaaatgctttatcac
ctaacagcacgatgtatacttcccaaatcagaaggtggcctggaagtagaagtcttattt
attgatacagattaccactttgatatgctccggctagttacaattcttgagcacagacta
tcccaaagctctgaagaaataatcaaatactgcctgggaagattttttttggtgtactgc
agtagtagcacccacttacttcttacactttactcactagaaagtatgttttgtagtcac
ccatctctctgccttttgattttggatagcctgtcagctttttactggatagaccgcgtc
aatggaggagaaagtgtgaacttacaggagtctactctgaggaaatgttctcagtgctta
gagaagcttgtaaatgactatcgcctggttctttttgcaacgacacaaactataatgcag
aaagcctcgagctcatcagaagaaccttctcatgcctctcgacgactgtgtgatgtggac
atagactacagaccttatctctgtaaggcatggcagcaactggtgaagcacaggatgttt
ttctccaaacaagatgattctcaaagcagcaaccaattttcattagtttcacgttgttta
aaaagtaacagtttaaaaaaacatttttttattattggagaaagtggggttgaattttgt
tga

DBGET integrated database retrieval system