KEGG   Homo sapiens (human): 85480
Entry
85480             CDS       T01001                                 
Symbol
TSLP
Name
(RefSeq) thymic stromal lymphopoietin
  KO
K05436  thymic stromal lymphopoietin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  JAK-STAT signaling pathway
Network
nt06518  JAK-STAT signaling
  Element
N01554  IL2 family to Jak-STAT signaling pathway
Disease
H01361  Eosinophilic esophagitis
Drug target
Tezepelumab: D11771<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    85480 (TSLP)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    85480 (TSLP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    85480 (TSLP)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   85480 (TSLP)
SSDB
Motif
Pfam: TSLP Tlr3_TMD
Other DBs
NCBI-GeneID: 85480
NCBI-ProteinID: NP_149024
OMIM: 607003
HGNC: 30743
Ensembl: ENSG00000145777
Pharos: Q969D9(Tbio)
UniProt: Q969D9
Structure
LinkDB
Position
5:111070062..111078026
AA seq 159 aa
MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKS
TEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINA
TQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
NT seq 480 nt   +upstreamnt  +downstreamnt
atgttcccttttgccttactatatgttctgtcagtttctttcaggaaaatcttcatctta
caacttgtagggctggtgttaacttacgacttcactaactgtgactttgagaagattaaa
gcagcctatctcagtactatttctaaagacctgattacatatatgagtgggaccaaaagt
accgagttcaacaacaccgtctcttgtagcaatcggccacattgccttactgaaatccag
agcctaaccttcaatcccaccgccggctgcgcgtcgctcgccaaagaaatgttcgccatg
aaaactaaggctgccttagctatctggtgcccaggctattcggaaactcagataaatgct
actcaggcaatgaagaagaggagaaaaaggaaagtcacaaccaataaatgtctggaacaa
gtgtcacaattacaaggattgtggcgtcgcttcaatcgacctttactgaaacaacagtaa

DBGET integrated database retrieval system