KEGG   Homo sapiens (human): 8976
Entry
8976              CDS       T01001                                 
Symbol
WASL, N-WASP, NWASP, WASPB
Name
(RefSeq) WASP like actin nucleation promoting factor
  KO
K23612  neural Wiskott-Aldrich syndrome protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04520  Adherens junction
hsa04810  Regulation of actin cytoskeleton
hsa05100  Bacterial invasion of epithelial cells
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05135  Yersinia infection
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01078  EGF-EGFR-Actin signaling pathway
N01092  Escherichia Eae/Tir to Actin signaling pathway
N01094  Escherichia Eae/Tir/TccP to Actin signaling pathway
N01096  Escherichia Map to CDC42 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    8976 (WASL)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    8976 (WASL)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    8976 (WASL)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    8976 (WASL)
   05132 Salmonella infection
    8976 (WASL)
   05131 Shigellosis
    8976 (WASL)
   05135 Yersinia infection
    8976 (WASL)
   05100 Bacterial invasion of epithelial cells
    8976 (WASL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8976 (WASL)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    8976 (WASL)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    8976 (WASL)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     8976 (WASL)
SSDB
Motif
Pfam: WH1 PBD WH2 DUF4918 PQQ
Other DBs
NCBI-GeneID: 8976
NCBI-ProteinID: NP_003932
OMIM: 605056
HGNC: 12735
Ensembl: ENSG00000106299
Pharos: O00401(Tbio)
UniProt: O00401
Structure
LinkDB
Position
7:complement(123681943..123749003)
AA seq 505 aa
MSSVQQQPPPPRRVTNVGSLLLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKK
CSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALN
FANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGPQVN
NISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCG
ISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHNSGPP
PPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGPPP
PPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLPSDGDHQVPTTAGNKAALLDQIREGAQLK
KVEQNSRPVSCSGRDALLDQIRQGIQLKSVADGQESTPPTPAPTSGIVGALMEVMQKRSK
AIHSSDEDEDEDDEEDFEDDDEWED
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgagctccgtccagcagcagccgccgccgccgcggagggtcaccaacgtggggtccctg
ttgctcaccccgcaggagaacgagtccctcttcactttcctcggcaagaaatgtgtgact
atgtcttcagcagtggtgcagttatatgcagcagatcggaactgtatgtggtcaaagaag
tgcagtggtgttgcttgtcttgttaaggacaatccacagagatcttattttttaagaata
tttgacattaaggatgggaaactattgtgggaacaagagctatacaataactttgtatat
aatagtcctagaggatattttcatacctttgctggagatacttgtcaagttgctcttaat
tttgccaatgaagaagaagcaaaaaaatttcgaaaagcagttacagaccttttgggccgt
cgacaaaggaaatctgagaaaagacgagatcccccaaatggtcctaatctacccatggct
acagttgatataaaaaatccagaaatcacaacaaatagattttatggtccacaagtcaac
aacatctcccataccaaagaaaagaagaagggaaaagctaaaaagaagagattaaccaag
gcagatataggaacaccaagcaatttccagcacattggacatgttggttgggatccaaat
acaggctttgatctgaataatttggatccagaattgaagaatcttttcgatatgtgtgga
atctcagaggcacaacttaaagacagagaaacatcaaaagttatatatgactttattgaa
aaaacaggaggtgttgaagctgttaaaaatgaactgcggaggcaagcaccaccacctcca
ccaccatcaaggggagggccacctcctcctcctccccctccacacaactcaggtcctcct
cctcctcctgctaggggaagaggcgctcctcccccaccaccttcaagagctcccacagct
gcacctccaccaccgcctccttccaggccaagtgtagcagtccctccaccaccgccaaat
aggatgtaccctcctccacctccagcccttccctcctcagcaccttcagggcctccacca
ccacctccatctgtgttgggggtagggccagtggcaccacccccaccgcctccacctcca
cctcctcctgggccaccgcccccgcctggcctgccttctgatggggaccatcaggttcca
actactgcaggaaacaaagcagctcttttagatcaaattagagagggtgctcagctaaaa
aaagtggagcagaacagtcggccagtgtcctgctctggacgagatgcactgttagaccag
atacgacagggtatccaactaaaatctgtggctgatggccaagagtctacaccaccaaca
cctgcacccacttcaggaattgtgggtgcattaatggaagtgatgcagaaaaggagcaaa
gccattcattcttcagatgaagatgaagatgaagatgatgaagaagattttgaggatgat
gatgagtgggaagactga

KEGG   Homo sapiens (human): 7456
Entry
7456              CDS       T01001                                 
Symbol
WIPF1, PRPL-2, WAS2, WASPIP, WIP
Name
(RefSeq) WAS/WASL interacting protein family member 1
  KO
K19475  WAS/WASL-interacting protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa05130  Pathogenic Escherichia coli infection
hsa05135  Yersinia infection
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01078  EGF-EGFR-Actin signaling pathway
N01092  Escherichia Eae/Tir to Actin signaling pathway
Disease
H01523  Wiskott-Aldrich syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    7456 (WIPF1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    7456 (WIPF1)
   05135 Yersinia infection
    7456 (WIPF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    7456 (WIPF1)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    7456 (WIPF1)
SSDB
Motif
Pfam: WH2 GRP
Other DBs
NCBI-GeneID: 7456
NCBI-ProteinID: NP_001070737
OMIM: 602357
HGNC: 12736
Ensembl: ENSG00000115935
Pharos: O43516(Tbio)
UniProt: O43516 Q2YDC4 A0A140VJZ9
Structure
LinkDB
Position
2:complement(174559574..174682913)
AA seq 503 aa
MPVPPPPAPPPPPTFALANTEKPTLNKTEQAGRNALLSDISKGKKLKKTVTNDRSAPILD
KPKGAGAGGGGGGFGGGGGFGGGGGGGGGGSFGGGGPPGLGGLFQAGMPKLRSTANRDND
SGGSRPPLLPPGGRSTSAKPFSPPSGPGRFPVPSPGHRSGPPEPQRNRMPPPRPDVGSKP
DSIPPPVPSTPRPIQSSPHNRGSPPVPGGPRQPSPGPTPPPFPGNRGTALGGGSIRQSPL
SSSSPFSNRPPLPPTPSRALDDKPPPPPPPVGNRPSIHREAVPPPPPQNNKPPVPSTPRP
SASSQAPPPPPPPSRPGPPPLPPSSSGNDETPRLPQRNLSLSSSTPPLPSPGRSGPLPPP
PSERPPPPVRDPPGRSGPLPPPPPVSRNGSTSRALPATPQLPSRSGVDSPRSGPRPPLPP
DRPSAGAPPPPPPSTSIRNGFQDSPCEDEWESRFYFHPISDLPPPEPYVQTTKSYPSKLA
RNESRSGSNRRERGAPPLPPIPR
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgcctgtccctccccctccagcacccccgccgcccccgacgtttgcactggccaataca
gagaagcctaccttgaataagacagagcaggctgggagaaatgctctcctttctgatatc
agcaaagggaagaaactaaagaagacggtcaccaatgacagaagtgcaccaatactggac
aaacctaaaggagctggtgctggaggcggtggtggtggctttggtggaggcggcggattt
ggcggaggaggtggtggcggaggcggtggaagttttggagggggcggacctccaggtctg
ggaggattgttccaggctggaatgccgaagctgagatccacggccaacagggataatgat
tctggaggaagccgaccaccattgttgccaccgggaggaagatccacatctgcgaaaccc
ttttcacccccaagtggcccagggaggtttcctgtgccttctccaggccacagaagtggt
cccccagagcctcagaggaaccgaatgccgcccccaaggcccgacgtgggctcaaagcct
gatagcattcctcctccagtacctagtactccaagacccattcaatcaagtccgcacaac
cgggggtccccaccagtgcccggaggccccaggcagcccagccccgggcccactcctccc
cctttccctggaaaccgcggcactgctttgggaggaggctcaatacgtcagtcccccttg
agctcctcctcgcccttctccaaccggcctcccctgccgcctacccccagcagggccttg
gatgacaaaccccctccaccacctcctccagtgggcaacaggccctccatccacagggaa
gcggttccccctcctcctcctcagaacaacaagcctccagtgccttccactccgcggcct
tcggcctcctcacaggccccacctccgccgccacctcccagcaggcccgggccgcctcct
ctgcctccaagttccagcggcaatgacgaaaccccaagactcccacagcggaatctgtcc
ctcagttcgtccacgcccccgttaccttcgccaggacgttcaggtcctcttcctcccccg
cccagtgagagacccccacctccagtgagggacccgccaggccgatcaggccccctccca
ccacctcctccagtaagcagaaacggcagcacatctcgggccctgcctgctacccctcag
ttgccatccaggagtggagtagacagtcccaggagtggacccaggcctccccttcctcct
gataggcccagtgctggggcacctcccccacctccaccatcaacatctattagaaatggc
ttccaagactctccatgtgaagatgagtgggaaagcagattctacttccatccgatttcc
gatttgccacctccagagccatatgtacaaacgaccaaaagttatcccagcaaactggca
agaaacgaaagccggagtggatccaaccgaagagaaaggggtgctccaccactccctccc
atcccgaggtga

KEGG   Homo sapiens (human): 147179
Entry
147179            CDS       T01001                                 
Symbol
WIPF2, WICH, WIRE
Name
(RefSeq) WAS/WASL interacting protein family member 2
  KO
K19475  WAS/WASL-interacting protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa05130  Pathogenic Escherichia coli infection
hsa05135  Yersinia infection
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01078  EGF-EGFR-Actin signaling pathway
N01092  Escherichia Eae/Tir to Actin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    147179 (WIPF2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    147179 (WIPF2)
   05135 Yersinia infection
    147179 (WIPF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    147179 (WIPF2)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    147179 (WIPF2)
SSDB
Motif
Pfam: WH2
Other DBs
NCBI-GeneID: 147179
NCBI-ProteinID: NP_573571
OMIM: 609692
HGNC: 30923
Ensembl: ENSG00000171475
Pharos: Q8TF74(Tbio)
UniProt: Q8TF74
LinkDB
Position
17:40219304..40284136
AA seq 440 aa
MPIPPPPPPPPGPPPPPTFHQANTEQPKLSRDEQRGRGALLQDICKGTKLKKVTNINDRS
APILEKPKGSSGGYGSGGAALQPKGGLFQGGVLKLRPVGAKDGSENLAGKPALQIPSSRA
AAPRPPVSAASGRPQDDTDSSRASLPELPRMQRPSLPDLSRPNTTSSTGMKHSSSAPPPP
PPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAPPPVKPPPSPVNIR
TGPSGQSLAPPPPPYRQPPGVPNGPSSPTNESAPELPQRHNSLHRKTPGPVRGLAPPPPT
SASPSLLSNRPPPPARDPPSRGAAPPPPPPVIRNGARDAPPPPPPYRMHGSEPPSRGKPP
PPPSRTPAGPPPPPPPPLRNGHRDSITTVRSFLDDFESKYSFHPVEDFPAPEEYKHFQRI
YPSKTNRAARGAPPLPPILR
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgccaattcctcctcccccgccacccccacctggtcctcctccacctcccacatttcat
caggcaaacacagagcagcccaagctgagtagagatgagcagcggggtcgaggcgccctc
ttacaggacatttgcaaagggaccaagctgaagaaggtgaccaacattaatgatcggagt
gctcccatcctcgagaagccgaaaggaagcagtggtggctatggctctggaggagctgcc
ctgcagcccaagggaggtctcttccaaggaggagtgctgaagcttcgacctgtgggagcc
aaggatggttcagagaacctagctggtaagccagccctgcaaatccccagttctcgagct
gctgccccaaggcctccagtatctgccgccagcgggcgtcctcaggatgatacagacagc
agccgggcctcactcccagaactgccccggatgcagagaccctctttaccggacctctct
cggcctaataccaccagcagtacgggcatgaagcacagctcctctgcccctcccccacca
cccccagggcggcgtgccaacgcaccccccacacctctgcctatgcacagcagcaaagcc
cccgcctacaacagagagaaacccttgccaccgacgcctggacaaaggcttcaccctggt
cgagagggacctcctgctccacccccagtcaaaccacctccttcccctgtgaatatcaga
acaggaccaagtggccagtctctggctcctcctcctccgccttaccgccagcctcctggg
gtccccaatggaccctctagccccactaatgagtcagcccctgagctgccacagagacac
aattctttgcataggaagacaccagggcctgtcagaggcctagcacctcctccacccacc
tcggcctccccatctttactgagtaataggccacctcccccagcccgagaccctcccagt
cggggagcagctcctccacccccaccacctgtgatccgaaatggtgccagggatgctccc
cctcccccaccaccataccgaatgcatgggtcagaacccccgagccgaggaaagccccca
cctccaccctcaaggacgccagctgggccaccccctcctcctccaccgcccctgaggaat
ggccacagagattctatcaccactgtccggtctttcttggatgattttgagtcaaagtat
tccttccatccagtagaagactttcctgctccagaagaatataaacactttcagaggata
tatcccagcaaaacaaaccgagctgcccgtggagccccacctctgccacccattctcagg
tga

KEGG   Homo sapiens (human): 644150
Entry
644150            CDS       T01001                                 
Symbol
WIPF3, CR16
Name
(RefSeq) WAS/WASL interacting protein family member 3
  KO
K19475  WAS/WASL-interacting protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa05130  Pathogenic Escherichia coli infection
hsa05135  Yersinia infection
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01078  EGF-EGFR-Actin signaling pathway
N01092  Escherichia Eae/Tir to Actin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    644150 (WIPF3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    644150 (WIPF3)
   05135 Yersinia infection
    644150 (WIPF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    644150 (WIPF3)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    644150 (WIPF3)
SSDB
Motif
Pfam: WH2
Other DBs
NCBI-GeneID: 644150
NCBI-ProteinID: NP_001073998
OMIM: 612432
HGNC: 22004
Ensembl: ENSG00000122574
Pharos: A6NGB9(Tdark)
UniProt: A6NGB9
LinkDB
Position
7:29806508..29917061
AA seq 483 aa
MPVPPPPPPPLPPPPPPLGAPPPPPPSAPPVSTDTSSLRRADPKGRSALLADIQQGTRLR
KVTQINDRSAPQIESSKGTNKEGGGSANTRGASTPPTLGDLFAGGFPVLRPAGQRDVAGG
KTGQGPGSRAPSPRLPNKTISGPLIPPASPRLGNTSEAHGAARTAPPRPNVPAPPPPTPP
PPPPPLPPPLPSSSPIKTPLVSPPGPLTKGNLPVVAPPVPCAPPPPPPPPPPTPPPLPPA
SVLSDKAVKPQLAPLHLPPIPPPLPLLPPCGYPGLKAEPASPAQDAQEPPAPPPPLPPYA
SCSPRASLPAPPLPGVNSSSETPPPLPPKSPSFQAPPQKAGAQALPAPPAPPGSQPFLQK
KRHGRPGAGGGKLNPPPAPPARSPTTELSSKSQQATAWTPTQQPGGQLRNGSLHIIDDFE
SKFTFHSVEDFPPPDEYKPCQKIYPSKIPRSRTPGPWLQAEAVGQSSDDIKGRNSQLSLK
TLR
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgccagtgccaccgccacccccacctcctctgcctccacctcccccgcctctgggggct
cctccccctcccccaccatcagcacccccggtaagcacagacacctccagcttgcgaagg
gcagatccgaaaggccggagtgcgctgttggctgatatccagcaaggaactcgcctgcgc
aaagtcacgcagatcaacgaccgcagtgccccgcagatcgagagttctaaaggaaccaac
aaagaaggaggaggttctgcaaacacacgaggcgcgagcacacctcccaccctgggagat
ctgtttgctggtggctttcctgtattgcgaccagcaggccagcgggatgtagcaggtggc
aagacagggcagggccctggctcccgcgcgccctctcccaggcttcccaacaaaaccatc
agcggcccgcttatcccgcctgcctctcccaggctaggcaatacctccgaggcgcatggc
gctgccaggacagccccgcctcgccccaacgtgcctgccccgccccctcccaccccaccc
cctccgcctccacccttacccccgccccttccctcttcctcccccatcaaaactccgctt
gtgtccccacccggcccactgaccaaagggaacctcccggtggttgcaccccccgtcccc
tgtgcgccaccacctccacctccgccacctcccccaacgccacccccgctgcccccggcc
tcggttcttagtgacaaggcagtgaagcctcagctggctcccttgcacctcccgcccatc
ccgcccccgctccctctgctcccaccttgtgggtatccggggctcaaagcggagcccgcc
agccctgcgcaagatgcgcaggagcctcccgccccgccgcccccgctccccccttatgct
tcttgctccccgagggcttctttgcccgcgccccctttgccaggagttaatagcagcagt
gaaactccacccccgctaccccctaaatcccccagcttccaggccccaccgcagaaggcc
ggtgcgcaggccttgcccgccccgcctgcccctccgggctcccagccgttcctgcagaag
aagaggcatggccgaccaggggccggtgggggaaagctaaatccacctccagcaccccct
gcgagatcacctaccacagagctttcaagcaagagccagcaggccacagcctggaccccg
acgcagcagcctggaggtcaactgcgaaatggaagcctgcacatcattgatgacttcgag
tctaaattcacgttccattctgtggaagactttccccctccggatgaatataaaccatgc
cagaagatttaccccagcaagatccccagaagccgtacacctggtccctggctccaagcg
gaagcagtcgggcagagctctgatgacatcaaaggcagaaattctcagttatctctaaag
actcttcggtga

DBGET integrated database retrieval system