KEGG   Homo sapiens (human): 9170
Entry
9170              CDS       T01001                                 

Symbol
LPAR2, EDG-4, EDG4, LPA-2, LPA2
Name
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05130  Pathogenic Escherichia coli infection
hsa05200  Pathways in cancer
Network
nt06124  Chemokine signaling (viruses)
nt06135  Cytoskeletal regulation (viruses and bacteria)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00408  LPAR-GNB/G-Rho signaling pathway
N01097  LPA-GNA12/13-RhoA signaling pathway
N01104  LPA-GNAQ/11-RhoA signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    9170 (LPAR2)
   04072 Phospholipase D signaling pathway
    9170 (LPAR2)
   04151 PI3K-Akt signaling pathway
    9170 (LPAR2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    9170 (LPAR2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    9170 (LPAR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    9170 (LPAR2)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    9170 (LPAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    9170 (LPAR2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    9170 (LPAR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srt
Other DBs
NCBI-GeneID: 9170
NCBI-ProteinID: NP_001382589
OMIM: 605110
HGNC: 3168
Ensembl: ENSG00000064547
Vega: OTTHUMG00000182328
Pharos: Q9HBW0(Tchem)
UniProt: Q9HBW0 A0A024R7M9
LinkDB
Position
19p13.11
AA seq 348 aa
MGQCYYNETIGFFYNNSGKELSSHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASNRRF
HQPIYYLLGNLAAADLFAGVAYLFLMFHTGPRTARLSLEGWFLRQGLLDTSLTASVATLL
AIAVERHRSVMAVQLHSRLPRGRVVMLIVGVWVAALGLGLLPAHSWHCLCALDRCSRMAP
LLSRSYLAVWALSSLLVFLLMVAVYTRIFFYVRRRVQRMAEHVSCHPRYRETTLSLVKTV
VIILGAFVVCWTPGQVVLLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDAEMR
RTFRRLLCCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDSTL
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgggccagtgctactacaacgagaccatcggcttcttctataacaacagtggcaaagag
ctcagctcccactggcggcccaaggatgtggtcgtggtggcactggggctgaccgtcagc
gtgctggtgctgctgaccaatctgctggtcatagcagccatcgcctccaaccgccgcttc
caccagcccatctactacctgctcggcaatctggccgcggctgacctcttcgcgggcgtg
gcctacctcttcctcatgttccacactggtccccgcacagcccgactttcacttgagggc
tggttcctgcggcagggcttgctggacacaagcctcactgcgtcggtggccacactgctg
gccatcgccgtggagcggcaccgcagtgtgatggccgtgcagctgcacagccgcctgccc
cgtggccgcgtggtcatgctcattgtgggcgtgtgggtggctgccctgggcctggggctg
ctgcctgcccactcctggcactgcctctgtgccctggaccgctgctcacgcatggcaccc
ctgctcagccgctcctatttggccgtctgggctctgtcgagcctgcttgtcttcctgctc
atggtggctgtgtacacccgcattttcttctacgtgcggcggcgagtgcagcgcatggca
gagcatgtcagctgccacccccgctaccgagagaccacgctcagcctggtcaagactgtt
gtcatcatcctgggggcgttcgtggtctgctggacaccaggccaggtggtactgctcctg
gatggtttaggctgtgagtcctgcaatgtcctggctgtagaaaagtacttcctactgttg
gccgaggccaactccctggtcaatgctgctgtgtactcttgccgagatgctgagatgcgc
cgcaccttccgccgccttctctgctgcgcgtgcctccgccagtccacccgcgagtctgtc
cactatacatcctctgcccagggaggtgccagcactcgcatcatgcttcccgagaacggc
cacccactgatggactccaccctttag

DBGET integrated database retrieval system