KEGG   Homo sapiens (human): 94030
Entry
94030             CDS       T01001                                 
Symbol
LRRC4B, HSM, LRIG4, NGL-3
Name
(RefSeq) leucine rich repeat containing 4B
  KO
K16360  netrin-G3 ligand
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    94030 (LRRC4B)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 I-set Ig_3 ig LRR_9 V-set LRRNT Ig_2 LRR_1
Other DBs
NCBI-GeneID: 94030
NCBI-ProteinID: NP_001073926
HGNC: 25042
Ensembl: ENSG00000131409
Pharos: Q9NT99(Tdark)
UniProt: Q9NT99 A0A024R4I8
LinkDB
Position
19:complement(50516892..50568435)
AA seq 713 aa
MARARGSPCPPLPPGRMSWPHGALLFLWLFSPPLGAGGGGVAVTSAAGGGSPPATSCPVA
CSCSNQASRVICTRRDLAEVPASIPVNTRYLNLQENGIQVIRTDTFKHLRHLEILQLSKN
LVRKIEVGAFNGLPSLNTLELFDNRLTTVPTQAFEYLSKLRELWLRNNPIESIPSYAFNR
VPSLRRLDLGELKRLEYISEAAFEGLVNLRYLNLGMCNLKDIPNLTALVRLEELELSGNR
LDLIRPGSFQGLTSLRKLWLMHAQVATIERNAFDDLKSLEELNLSHNNLMSLPHDLFTPL
HRLERVHLNHNPWHCNCDVLWLSWWLKETVPSNTTCCARCHAPAGLKGRYIGELDQSHFT
CYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTSVNWLTPNGTLMTHGSYRVRISVLHDGT
LNFTNVTVQDTGQYTCMVTNSAGNTTASATLNVSAVDPVAAGGTGSGGGGPGGSGGVGGG
SGGYTYFTTVTVETLETQPGEEALQPRGTEKEPPGPTTDGVWGGGRPGDAAGPASSSTTA
PAPRSSRPTEKAFTVPITDVTENALKDLDDVMKTTKIIIGCFVAITFMAAVMLVAFYKLR
KQHQLHKHHGPTRTVEIINVEDELPAASAVSVAAAAAVASGGGVGGDSHLALPALERDHL
NHHHYVAAAFKAHYSSNPSGGGCGGKGPPGLNSIHEPLLFKSGSKENVQETQI
NT seq 2142 nt   +upstreamnt  +downstreamnt
atggcgcgtgcccgcggctccccgtgccccccgctgccgcccggtaggatgtcctggccc
cacggggcattgctcttcctctggctcttctccccacccctgggggccggtggaggtgga
gtggccgtgacgtctgccgccggagggggctccccgccggccacctcctgccccgtggcc
tgctcctgcagcaaccaggccagccgggtgatctgcacacggagagacctggccgaggtc
ccagccagcatcccggtcaacacgcggtacctgaacctgcaagagaacggcatccaggtg
atccggacggacacgttcaagcacctgcggcacctggagattctgcagctgagcaagaac
ctggtgcgcaagatcgaggtgggcgccttcaacgggctgcccagcctcaacacgctggag
ctttttgacaaccggctgaccacggtgcccacgcaggccttcgagtacctgtccaagctg
cgggagctctggctgcggaacaaccccatcgagagcatcccctcctacgccttcaaccgc
gtgccctcgctgcggcgcctggacctgggcgagctcaagcggctggaatacatctcggag
gcggccttcgaggggctggtcaacctgcgctacctcaacctgggcatgtgcaacctcaag
gacatccccaacctgacggccctggtgcgcctggaggagctggagctgtcgggcaaccgg
ctggacctgatccgcccgggctccttccagggtctcaccagcctgcgcaagctgtggctc
atgcacgcccaggtagccaccatcgagcgcaacgccttcgacgacctcaagtcgctggag
gagctcaacctgtcccacaacaacctgatgtcgctgccccacgacctcttcacgcccctg
caccgcctcgagcgcgtgcacctcaaccacaacccctggcattgcaactgcgacgtgctc
tggctgagctggtggctcaaggagacggtgcccagcaacacgacgtgctgcgcccgctgt
catgcgcccgccggcctcaaggggcgctacattggggagctggaccagtcgcatttcacc
tgctatgcgcccgtcatcgtggagccgcccacggacctcaacgtcaccgagggcatggct
gccgagctcaaatgccgcacgggcacctccatgacctccgtcaactggctgacgcccaac
ggcaccctcatgacccacggctcctaccgcgtgcgcatctccgtcctgcatgacggcacg
cttaacttcaccaacgtcaccgtgcaggacacgggccagtacacgtgcatggtgacgaac
tcagccggcaacaccaccgcctcggccacgctcaacgtctcggccgtggaccccgtggcg
gccgggggcaccggcagcggcgggggcggccctgggggcagtggtggtgttggagggggc
agtggcggctacacctacttcaccacggtgaccgtggagaccctggagacgcagcccgga
gaggaggccctgcagccgcgggggacggagaaggaaccgccagggcccacgacagacggt
gtctggggtgggggccggcctggggacgcggccggccctgcctcgtcttctaccacggca
cccgccccgcgctcctcgcggcccacggagaaggcgttcacggtgcccatcacggatgtg
acggagaacgccctcaaggacctggacgacgtcatgaagaccaccaaaatcatcatcggc
tgcttcgtggccatcacgttcatggccgcggtgatgctcgtggccttctacaagctgcgc
aagcagcaccagctccacaagcaccacgggcccacgcgcaccgtggagatcatcaacgtg
gaggacgagctgcccgccgcctcggccgtgtccgtggccgccgcggccgccgtggccagt
gggggtggtgtgggcggggacagccacctggccctgcccgccctggagcgagaccacctc
aaccaccaccactacgtggctgccgccttcaaggcgcactacagcagcaaccccagcggc
gggggctgcgggggcaaaggcccgcctggcctcaactccatccacgaacctctgctcttc
aagagcggctccaaggagaacgtgcaagagacgcagatctga

DBGET integrated database retrieval system