KEGG   Homo sapiens (human): 9466
Entry
9466              CDS       T01001                                 
Symbol
IL27RA, CRL1, IL-27RA, IL27R, TCCR, WSX1, zcytor1
Name
(RefSeq) interleukin 27 receptor subunit alpha
  KO
K19598  interleukin 27 receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  JAK-STAT signaling pathway
hsa04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    9466 (IL27RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    9466 (IL27RA)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    9466 (IL27RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    9466 (IL27RA)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL6/12 receptor family
   9466 (IL27RA)
SSDB
Motif
Pfam: fn3
Other DBs
NCBI-GeneID: 9466
NCBI-ProteinID: NP_004834
OMIM: 605350
HGNC: 17290
Ensembl: ENSG00000104998
Vega: OTTHUMG00000181990
Pharos: Q6UWB1(Tbio)
UniProt: Q6UWB1
LinkDB
Position
19:14031762..14053218
AA seq 636 aa
MRGGRGAPFWLWPLPKLALLPLLWVLFQRTRPQGSAGPLQCYGVGPLGDLNCSWEPLGDL
GAPSELHLQSQKYRSNKTQTVAVAAGRSWVAIPREQLTMSDKLLVWGTKAGQPLWPPVFV
NLETQMKPNAPRLGPDVDFSEDDPLEATVHWAPPTWPSHKVLICQFHYRRCQEAAWTLLE
PELKTIPLTPVEIQDLELATGYKVYGRCRMEKEEDLWGEWSPILSFQTPPSAPKDVWVSG
NLCGTPGGEEPLLLWKAPGPCVQVSYKVWFWVGGRELSPEGITCCCSLIPSGAEWARVSA
VNATSWEPLTNLSLVCLDSASAPRSVAVSSIAGSTELLVTWQPGPGEPLEHVVDWARDGD
PLEKLNWVRLPPGNLSALLPGNFTVGVPYRITVTAVSASGLASASSVWGFREELAPLVGP
TLWRLQDAPPGTPAIAWGEVPRHQLRGHLTHYTLCAQSGTSPSVCMNVSGNTQSVTLPDL
PWGPCELWVTASTIAGQGPPGPILRLHLPDNTLRWKVLPGILFLWGLFLLGCGLSLATSG
RCYHLRHKVLPRWVWEKVPDPANSSSGQPHMEQVPEAQPLGDLPILEVEEMEPPPVMESS
QPAQATAPLDSGYEKHFLPTPEELGLLGPPRPQVLA
NT seq 1911 nt   +upstreamnt  +downstreamnt
atgcggggaggcaggggcgcccctttctggctgtggccgctgcccaagctggcgctgctg
cctctgttgtgggtgcttttccagcggacgcgtccccagggcagcgccgggccactgcag
tgctacggagttggacccttgggcgacttgaactgctcgtgggagcctcttggggacctg
ggagccccctccgagttacacctccagagccaaaagtaccgttccaacaaaacccagact
gtggcagtggcagccggacggagctgggtggccattcctcgggaacagctcaccatgtct
gacaaactccttgtctggggcactaaggcaggccagcctctctggccccccgtcttcgtg
aacctagaaacccaaatgaagccaaacgccccccggctgggccctgacgtggacttttcc
gaggatgaccccctggaggccactgtccattgggccccacctacatggccatctcataaa
gttctgatctgccagttccactaccgaagatgtcaggaggcggcctggaccctgctggaa
ccggagctgaagaccatacccctgacccctgttgagatccaagatttggagctagccact
ggctacaaagtgtatggccgctgccggatggagaaagaagaggatttgtggggcgagtgg
agccccattttgtccttccagacaccgccttctgctccaaaagatgtgtgggtatcaggg
aacctctgtgggacgcctggaggagaggaacctttgcttctatggaaggccccagggccc
tgtgtgcaggtgagctacaaagtctggttctgggttggaggtcgtgagctgagtccagaa
ggaattacctgctgctgctccctaattcccagtggggcggagtgggccagggtgtccgct
gtcaacgccacaagctgggagcctctcaccaacctctctttggtctgcttggattcagcc
tctgccccccgtagcgtggcagtcagcagcatcgctgggagcacggagctactggtgacc
tggcaaccggggcctggggaaccactggagcatgtagtggactgggctcgagatggggac
cccctggagaaactcaactgggtccggcttccccctgggaacctcagtgctctgttacca
gggaatttcactgtcggggtcccctatcgaatcactgtgaccgcagtctctgcttcaggc
ttggcctctgcatcctccgtctgggggttcagggaggaattagcacccctagtggggcca
acgctttggcgactccaagatgcccctccagggacccccgccatagcgtggggagaggtc
ccaaggcaccagcttcgaggccacctcacccactacaccttgtgtgcacagagtggaacc
agcccctccgtctgcatgaatgtgagtggcaacacacagagtgtcaccctgcctgacctt
ccttggggtccctgtgagctgtgggtgacagcatctaccatcgctggacagggccctcct
ggtcccatcctccggcttcatctaccagataacaccctgaggtggaaagttctgccgggc
atcctattcttgtggggcttgttcctgttggggtgtggcctgagcctggccacctctgga
aggtgctaccacctaaggcacaaagtgctgccccgctgggtctgggagaaagttcctgat
cctgccaacagcagttcaggccagccccacatggagcaagtacctgaggcccagcccctt
ggggacttgcccatcctggaagtggaggagatggagcccccgccggttatggagtcctcc
cagcccgcccaggccaccgccccgcttgactctgggtatgagaagcacttcctgcccaca
cctgaggagctgggccttctggggccccccaggccacaggttctggcctga

DBGET integrated database retrieval system