KEGG   Homo sapiens (human): 9562
Entry
9562              CDS       T01001                                 
Symbol
MINPP1, HIPER1, MINPP2, MIPP, PCH16
Name
(RefSeq) multiple inositol-polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
Disease
H00032  Thyroid cancer
H00897  Pontocerebellar hypoplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    9562 (MINPP1)
   00562 Inositol phosphate metabolism
    9562 (MINPP1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     9562 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     9562 (MINPP1)
SSDB
Motif
Pfam: His_Phos_2 SID
Other DBs
NCBI-GeneID: 9562
NCBI-ProteinID: NP_004888
OMIM: 605391
HGNC: 7102
Ensembl: ENSG00000107789
Vega: OTTHUMG00000018678
Pharos: Q9UNW1(Tbio)
UniProt: Q9UNW1
LinkDB
Position
10:87504893..87553461
AA seq 487 aa
MLRAPGCLLRTSVAPAAALAAALLSSLARCSLLEPRDPVASSLSPYFGTKTRYEDVNPVL
LSGPEAPWRDPELLEGTCTPVQLVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGAS
STGSRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLI
TSSKHRCMDSSAAFLQGLWQHYHPGLPPPDVADMEFGPPTVNDKLMRFFDHCEKFLTEVE
KNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADLIQVAFFTCSFDLAIKGVKSP
WCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKAVEQKQRSQPI
SSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKKQMHRKFRSGLIVPYASNLIFVLY
HCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDLKNHYKDILQSCQTSEECELARA
NSTSDEL
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgctacgcgcgcccggctgcctcctccggacctccgtagcgcctgccgcggccctggct
gcggcgctgctctcgtcgcttgcgcgctgctctcttctagagccgagggacccggtggcc
tcgtcgctcagcccctatttcggcaccaagactcgctacgaggatgtcaaccccgtgcta
ttgtcgggccccgaggctccgtggcgggaccctgagctgctggaggggacctgcaccccg
gtgcagctggtcgccctcattcgccacggcacccgctaccccacggtcaaacagatccgc
aagctgaggcagctgcacgggttgctgcaggcccgcgggtccagggatggcggggctagt
agtaccggcagccgcgacctgggtgcagcgctggccgactggcctttgtggtacgcggac
tggatggacgggcagctagtagagaagggacggcaggatatgcgacagctggcgctgcgt
ctggcctcgctcttcccggcccttttcagccgtgagaactacggccgcctgcggctcatc
accagttccaagcaccgctgcatggatagcagcgccgccttcctgcaggggctgtggcag
cactaccaccctggcttgccgccgccggacgtcgcagatatggagtttggacctccaaca
gttaatgataaactaatgagattttttgatcactgtgagaagtttttaactgaagtagaa
aaaaatgctacagctctttatcacgtggaagccttcaaaactggaccagaaatgcagaac
attttaaaaaaagttgcagctactttgcaagtgccagtaaatgatttaaatgcagattta
attcaagtagcctttttcacctgttcatttgacctggcaattaaaggtgttaaatctcct
tggtgtgatgtttttgacatagatgatgcaaaggtattagaatatttaaatgatctgaaa
caatattggaaaagaggatatgggtatactattaacagtcgatccagctgcaccttgttt
caggatatctttcagcacttggacaaagcagttgaacagaaacaaaggtctcagccaatt
tcttctccagtcatcctccagtttggtcatgcagagactcttcttccactgctttctctc
atgggctacttcaaagacaaggaacccctaacagcgtacaattacaaaaaacaaatgcat
cggaagttccgaagtggtctcattgtaccttatgcctcgaacctgatatttgtgctttac
cactgtgaaaatgctaagactcctaaagaacaattccgagtgcagatgttattaaatgaa
aaggtgttacctttggcttactcacaagaaactgtttcattttatgaagatctgaagaac
cactacaaggacatccttcagagttgtcaaaccagtgaagaatgtgaattagcaagggct
aacagtacatctgatgaactatga

DBGET integrated database retrieval system