KEGG   Homo sapiens (human): 9688
Entry
9688              CDS       T01001                                 
Symbol
NUP93, NIC96
Name
(RefSeq) nucleoporin 93
  KO
K14309  nuclear pore complex protein Nup93
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  Nucleocytoplasmic transport
hsa05014  Amyotrophic lateral sclerosis
Network
nt06424  RNA processing
nt06464  Amyotrophic lateral sclerosis
  Element
N01152  Nuclear export of mRNA
N01153  Mutation-caused aberrant GLE1 to nuclear export of mRNA
Disease
H01657  Nephrotic syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    9688 (NUP93)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    9688 (NUP93)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    9688 (NUP93)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     9688 (NUP93)
SSDB
Motif
Pfam: Nic96 Nup84_Nup100 Clathrin
Other DBs
NCBI-GeneID: 9688
NCBI-ProteinID: NP_055484
OMIM: 614351
HGNC: 28958
Ensembl: ENSG00000102900
Vega: OTTHUMG00000133278
Pharos: Q8N1F7(Tbio)
UniProt: Q8N1F7
Structure
LinkDB
Position
16:56730129..56850286
AA seq 819 aa
MDTEGFGELLQQAEQLAAETEGISELPHVERNLQEIQQAGERLRSRTLTRTSQETADVKA
SVLLGSRGLDISHISQRLESLSAATTFEPLEPVKDTDIQGFLKNEKDNALLSAIEESRKR
TFGMAEEYHRESMLVEWEQVKQRILHTLLASGEDALDFTQESEPSYISDVGPPGRSSLDN
IEMAYARQIYIYNEKIVNGHLQPNLVDLCASVAELDDKSISDMWTMVKQMTDVLLTPATD
ALKNRSSVEVRMEFVRQALAYLEQSYKNYTLVTVFGNLHQAQLGGVPGTYQLVRSFLNIK
LPAPLPGLQDGEVEGHPVWALIYYCMRCGDLLAASQVVNRAQHQLGEFKTWFQEYMNSKD
RRLSPATENKLRLHYRRALRNNTDPYKRAVYCIIGRCDVTDNQSEVADKTEDYLWLKLNQ
VCFDDDGTSSPQDRLTLSQFQKQLLEDYGESHFTVNQQPFLYFQVLFLTAQFEAAVAFLF
RMERLRCHAVHVALVLFELKLLLKSSGQSAQLLSHEPGDPPCLRRLNFVRLLMLYTRKFE
STDPREALQYFYFLRDEKDSQGENMFLRCVSELVIESREFDMILGKLENDGSRKPGVIDK
FTSDTKPIINKVASVAENKGLFEEAAKLYDLAKNADKVLELMNKLLSPVVPQISAPQSNK
ERLKNMALSIAERYRAQGISANKFVDSTFYLLLDLITFFDEYHSGHIDRAFDIIERLKLV
PLNQESVEERVAAFRNFSDEIRHNLSEVLLATMNILFTQFKRLKGTSPSSSSRPQRVIED
RDSQLRSQARTLITFAGMIPYRTSGDTNARLVQMEVLMN
NT seq 2460 nt   +upstreamnt  +downstreamnt
atggatactgaggggtttggtgagctccttcagcaagctgaacagcttgctgctgagact
gagggcatctcagagcttccccatgtggaacggaacttacaggagatccagcaggcggga
gagcgcctgcgttcccgtaccctaacacgcacgtcccaggagacggcagatgtcaaggcg
tcagttctcctcgggtctcggggacttgacatatcccacatctcccagcgattggagagt
ctgagtgcagccaccacctttgagcctcttgagcctgtgaaggacactgacattcagggc
ttcctgaagaatgagaaggacaatgccctgctgtctgccatcgaagagtcccggaagagg
accttcggcatggctgaggagtaccatcgggagtcaatgttggttgagtgggagcaagtg
aaacagcgaattctgcacacactgctggcatcaggagaagacgcccttgactttactcaa
gaaagcgagccaagctacatcagtgatgtgggaccccctggtcgaagctctctggataac
atcgagatggcctatgcgcggcaaatttatatctataatgagaaaattgtaaatggacac
ctgcagcctaacctggtggacctttgtgcttccgtcgcagagctcgatgataagagcatt
tccgacatgtggaccatggtaaaacaaatgacagacgtgttgttgacaccggcaacggat
gccctgaagaaccgcagcagcgtggaagtgcgcatggagtttgtcaggcaggccttggcg
taccttgagcagagttataagaattacacccttgtgactgtctttggaaatttgcatcag
gcccagctgggcggggtgcctgggacttaccaattggttcgaagtttcctgaacattaaa
ctgccagctcccttgcctggactacaggatggagaggtggaaggccatcctgtgtgggcg
ctaatttactactgcatgcgctgtggagacctgcttgccgcttcacaggtagttaatcga
gcccagcaccagctgggagagtttaaaacctggttccaggagtacatgaacagcaaggac
agaagattgtccccagctacggaaaacaagctccggctgcattaccgtagggccctcagg
aacaatacagatccctacaagcgggccgtgtactgtatcattggcagatgtgacgtcacc
gacaaccagagtgaagtggcggacaaaactgaggattacctgtggctgaagttgaaccaa
gtgtgttttgacgacgatggcaccagctccccacaagacaggctcactctctcacagttc
cagaagcagttgttggaagactatggcgagtcccactttacggtgaaccagcaacccttc
ctctacttccaagtcctgttcctgacagcgcagtttgaagcagcagttgcctttcttttc
cgcatggagcggctgcgctgccatgctgtccatgtagcactggtgctgtttgagctgaag
ctgcttttaaagtcctctggacagagtgctcagctcctcagccacgagcctggtgaccct
ccttgcttgcggcggctgaacttcgtgcggctcctcatgctgtacacccggaagtttgag
tccacggacccaagggaggccctccagtacttctatttcctcagggatgagaaagatagt
caaggagaaaacatgtttctgcgctgtgtgagtgagcttgtgattgaaagccgagagttc
gatatgattcttgggaaactagagaatgacggaagtagaaagcctggagtcatagataag
tttactagtgacacaaagcctattatcaacaaagttgcttctgtggcagaaaataaagga
ctgtttgaagaggcagcaaagctgtatgaccttgccaagaatgctgacaaggtactggag
ctgatgaacaaactgctgagccctgtcgtcccccagatcagtgccccgcaatccaacaag
gagaggctgaagaacatggcactctccattgccgaacggtatagggctcaaggaataagc
gcaaataaatttgtggactccacgttctatcttcttttggacttgatcaccttttttgac
gagtatcatagtggtcatattgatagagcttttgatatcattgagcgcttgaagctggtg
cccctgaatcaggaaagtgtggaagagagagtggctgccttcagaaatttcagtgatgaa
atcaggcacaacctctcagaagtgcttcttgccaccatgaacatcttgttcacacagttt
aagaggctcaaggggacaagtccatcctcgtcatccaggccccagcgagtcatcgaggac
cgcgactctcaactccgaagtcaagcccgcactctgattacctttgctggaatgatacca
taccgaacgtctggggacaccaatgcgaggctggtgcagatggaggtcctcatgaattaa

DBGET integrated database retrieval system