KEGG   Homo sapiens (human): 9730
Entry
9730              CDS       T01001                                 
Symbol
DCAF1, RIP, VPRBP
Name
(RefSeq) DDB1 and CUL4 associated factor 1
  KO
K11789  DDB1- and CUL4-associated factor 1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05170  Human immunodeficiency virus 1 infection
Network
nt06130  Cell cycle (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
  Element
N00456  HIV Vpr to CDC25-cell cycle G2M
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    9730 (DCAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    9730 (DCAF1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    9730 (DCAF1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     9730 (DCAF1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  Other
   9730 (DCAF1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     9730 (DCAF1)
SSDB
Motif
Pfam: ANAPC4_WD40
Other DBs
NCBI-GeneID: 9730
NCBI-ProteinID: NP_055518
OMIM: 617259
HGNC: 30911
Ensembl: ENSG00000145041
Vega: OTTHUMG00000156895
Pharos: Q9Y4B6(Tbio)
UniProt: Q9Y4B6
Structure
LinkDB
Position
3:complement(51395867..51505639)
AA seq 1507 aa
MTTVVVHVDSKAELTTLLEQWEKEHGSGQDMVPILTRMSQLIEKETEEYRKGDPDPFDDR
HPGRADPECMLGHLLRILFKNDDFMNALVNAYVMTSREPPLNTAACRLLLDIMPGLETAV
VFQEKEGIVENLFKWAREADQPLRTYSTGLLGGAMENQDIAANYRDENSQLVAIVLRRLR
ELQLQEVALRQENKRPSPRKLSSEPLLPLDEEAVDMDYGDMAVDVVDGDQEEASGDMEIS
FHLDSGHKTSSRVNSTTKPEDGGLKKNKSAKQGDRENFRKAKQKLGFSSSDPDRMFVELS
NSSWSEMSPWVIGTNYTLYPMTPAIEQRLILQYLTPLGEYQELLPIFMQLGSRELMMFYI
DLKQTNDVLLTFEALKHLASLLLHNKFATEFVAHGGVQKLLEIPRPSMAATGVSMCLYYL
SYNQDAMERVCMHPHNVLSDVVNYTLWLMECSHASGCCHATMFFSICFSFRAVLELFDRY
DGLRRLVNLISTLEILNLEDQGALLSDDEIFASRQTGKHTCMALRKYFEAHLAIKLEQVK
QSLQRTEGGILVHPQPPYKACSYTHEQIVEMMEFLIEYGPAQLYWEPAEVFLKLSCVQLL
LQLISIACNWKTYYARNDTVRFALDVLAILTVVPKIQLQLAESVDVLDEAGSTVSTVGIS
IILGVAEGEFFIHDAEIQKSALQIIINCVCGPDNRISSIGKFISGTPRRKLPQNPKSSEH
TLAKMWNVVQSNNGIKVLLSLLSIKMPITDADQIRALACKALVGLSRSSTVRQIISKLPL
FSSCQIQQLMKEPVLQDKRSDHVKFCKYAAELIERVSGKPLLIGTDVSLARLQKADVVAQ
SRISFPEKELLLLIRNHLISKGLGETATVLTKEADLPMTAASHSSAFTPVTAAASPVSLP
RTPRIANGIATRLGSHAAVGASAPSAPTAHPQPRPPQGPLALPGPSYAGNSPLIGRISFI
RERPSPCNGRKIRVLRQKSDHGAYSQSPAIKKQLDRHLPSPPTLDSIITEYLREQHARCK
NPVATCPPFSLFTPHQCPEPKQRRQAPINFTSRLNRRASFPKYGGVDGGCFDRHLIFSRF
RPISVFREANEDESGFTCCAFSARERFLMLGTCTGQLKLYNVFSGQEEASYNCHNSAITH
LEPSRDGSLLLTSATWSQPLSALWGMKSVFDMKHSFTEDHYVEFSKHSQDRVIGTKGDIA
HIYDIQTGNKLLTLFNPDLANNYKRNCATFNPTDDLVLNDGVLWDVRSAQAIHKFDKFNM
NISGVFHPNGLEVIINTEIWDLRTFHLLHTVPALDQCRVVFNHTGTVMYGAMLQADDEDD
LMEERMKSPFGSSFRTFNATDYKPIATIDVKRNIFDLCTDTKDCYLAVIENQGSMDALNM
DTVCRLYEVGRQRLAEDEDEEEDQEEEEQEEEDDDEDDDDTDDLDELDTDQLLEAELEED
DNNENAGEDGDNDFSPSDEELANLLEEGEDGEDEDSDADEEVELILGDTDSSDNSDLEDD
IILSLNE
NT seq 4524 nt   +upstreamnt  +downstreamnt
atgactacagtagtggtacatgtggactccaaagctgagctcactaccctgctggagcag
tgggaaaaggaacatggcagtgggcaggacatggtacctatccttaccaggatgtctcaa
ttgattgaaaaagaaactgaagagtatcgtaaaggggatccagacccatttgatgatcga
catcctggtcgagctgatccagagtgtatgctgggccacttgctgagaatactcttcaag
aatgatgatttcatgaatgcactggtgaatgcatatgtgatgacaagccgagagccccct
ttaaacactgcagcttgcagactcctattagacatcatgccagggctggaaactgctgtc
gtctttcaagaaaaggagggaattgtcgagaatcttttcaaatgggcccgagaggccgat
caaccattgaggacatattctactggactgttaggaggtgctatggaaaatcaagacatt
gctgccaactatagagatgaaaattcacagctggtggcaatagtgcttcgaagactgagg
gagctacagctacaggaagtggctttgcggcaggaaaacaagcgtcccagtccacggaag
ctctcttctgaaccccttttgcctctggatgaggaggctgtggatatggactatggtgac
atggctgtagatgtagtggatggagaccaagaggaagcttctggagacatggagatctcc
tttcatcttgattcaggccacaagactagtagcagagtgaactcaacaaccaaacctgag
gatggaggattaaagaaaaacaagtcagcaaaacagggtgacagagagaactttaggaaa
gccaagcaaaagttgggtttctcatcttctgatccagatcgcatgtttgttgagctgtct
aatagcagttggtcagaaatgtctccctgggtgattggcaccaattataccctttatcct
atgactcctgctatcgagcagcgactcattctccaatatttgacccctctaggagaatat
caggagctacttcccatattcatgcaacttggatcacgggagctgatgatgttctatatt
gacctgaagcaaactaatgatgtcctgcttacatttgaggcactaaagcacctagcatct
ctcctgctccataacaaatttgccacagaatttgttgcgcatggtggagtacagaaatta
ctggaaatacctcgtccttctatggctgcaaccggtgtgtctatgtgtttgtattaccta
tcctacaatcaggatgccatggaaagagtttgcatgcatccccacaatgttctgtctgat
gtggtgaactataccctgtggttaatggagtgttctcatgcttcaggatgctgccatgct
accatgtttttttcaatttgcttctcatttcgggccgtcttggagctctttgaccgctat
gatggtcttcgtcgtctggtgaacttgatcagtactttggagattctaaatttggaagat
cagggtgcacttctgagtgatgatgaaatatttgctagccgccaaactgggaaacatacc
tgcatggccttgcgcaaatactttgaggctcacctggccattaaattggaacaagtgaag
cagtcacttcagaggactgagggtggcattcttgtccacccacaacccccgtacaaggca
tgctcatatactcatgaacagattgtggaaatgatggaatttttgatagaatatggccca
gcgcagctatattgggaaccagctgaagttttcctcaaactttcttgtgtgcaactcttg
ttgcagcttatttctattgcctgcaattggaagacctattatgcaaggaatgacactgtg
cgctttgctttggatgtcctggctattcttactgtggtgccaaaaatccagctccagttg
gcagaatcagtggacgtgttggatgaggctggatctacagtctctactgtaggtatcagc
attattttgggagtggctgagggtgagttcttcatccatgatgctgaaattcagaagtca
gcacttcagattatcatcaattgtgtgtgtggcccagataaccgaatatccagtattggt
aaatttatctctggtactcctcggagaaagctgcctcagaaccctaaaagcagtgagcac
accctggccaagatgtggaatgtggttcagtccaacaacggcatcaaggtgctcctgtcc
ttactgtccattaagatgcccatcacagatgcagaccaaatccgggccctggcctgcaaa
gccctagtgggcctgtctcgcagtagcactgtccggcagatcatcagtaaactgcccctt
ttcagcagctgccagatccagcagctgatgaaggagcctgtgctgcaggacaagcgcagt
gaccatgtcaagttctgcaagtatgctgctgaactcattgaacgggtgtcaggaaaacca
cttctcattggcactgatgtttccctagcacgactgcagaaagcagatgttgttgcccag
tcaaggatctccttccctgagaaagagctgcttttgttgatacgaaaccatcttatttct
aaagggcttggagaaacagcaaccgtgctgacaaaagaggctgacctgcccatgactgct
gcctcccattcttctgcctttaccccagtcactgctgctgcttctcctgtctctctaccc
cgaacccctcgtatcgctaatggcattgcaactcgtctgggcagccatgctgctgtgggt
gcctctgcgccttctgcccctactgctcatcctcagccacggcccccccagggtccgcta
gctctgcccggcccatcttatgcaggcaactcccctttgattggtagaatcagttttatc
agagagaggccatcaccctgcaatggcaggaaaatcagagtgttgcggcagaagtcggac
catggtgcctacagccaaagcccagccataaaaaaacagctggacagacatcttccttcc
ccacctacgctggacagtataatcacagagtatcttagagaacaacatgctcgctgcaag
aatccagttgccacctgcccacctttctccctctttactcctcaccaatgtcctgagcca
aaacagaggcggcaagcgccaataaactttacgtcaaggctaaaccgcagggcatcattt
ccaaagtatggaggggtggatggcggatgctttgataggcaccttatctttagcagattc
cgtcctatttcagtgttccgggaagccaatgaagatgagagtggcttcacctgctgtgca
ttctcagcacgggagcggttcctgatgcttggcacctgcacagggcagctgaagctctat
aatgtgtttagtggacaggaggaggccagctataactgtcacaactcagccatcacacat
cttgaaccttccagggatgggtccttgctgctgacatctgctacttggagccagcctttg
tctgcactttggggaatgaagtcagtatttgatatgaagcattccttcacagaagatcac
tatgttgagttcagtaagcactcccaggatcgggtcatcggcacaaaaggagacattgcc
cacatttatgatattcagactggcaacaagctgttgactctgtttaacccagatcttgcc
aacaactacaagaggaactgtgccacctttaatcctacagatgatcttgtcttaaatgat
ggcgtcctctgggatgtccgctctgcacaggccatccacaagtttgacaagttcaatatg
aacatcagtggtgttttccatccaaatggactggaggtgatcattaatactgagatttgg
gaccttcgaacttttcatcttttgcatactgttcccgctctggatcagtgtcgcgtggtg
ttcaatcacacgggaacagtgatgtatggagctatgttgcaggcagatgatgaagatgac
ttaatggaagagaggatgaaaagcccctttgggtcatccttccgaacatttaatgcaact
gactacaaacctatagcaaccattgatgtgaaacggaacatctttgacctgtgtacagac
accaaagactgctatcttgctgtcattgagaatcaaggcagcatggatgccctgaacatg
gacacagtatgcaggctgtatgaagtgggcaggcagcgtctggcagaggatgaggatgaa
gaggaggaccaggaagaggaagaacaggaggaagaagatgatgatgaagatgatgatgac
accgatgatttagatgagcttgacactgaccagttgctggaggcggagttggaggaggac
gacaataatgagaacgcaggggaagatggggacaatgacttctctccctctgatgaggag
ctagcaaaccttctagaggagggagaggacggggaggatgaagactctgatgcagatgag
gaggtggaactgatcctgggggacactgacagctctgacaactctgatttggaagatgac
atcatcttatctctgaatgagtga

KEGG   Homo sapiens (human): 1642
Entry
1642              CDS       T01001                                 
Symbol
DDB1, DDBA, UV-DDB1, WHIKERS, XAP1, XPCE, XPE, XPE-BF
Name
(RefSeq) damage specific DNA binding protein 1
  KO
K10610  DNA damage-binding protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03420  Nucleotide excision repair
hsa04120  Ubiquitin mediated proteolysis
hsa05161  Hepatitis B
hsa05170  Human immunodeficiency virus 1 infection
hsa05203  Viral carcinogenesis
Network
nt06130  Cell cycle (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
  Element
N00456  HIV Vpr to CDC25-cell cycle G2M
Disease
H00403  Disorders of nucleotide excision repair
H02560  White-Kernohan syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    1642 (DDB1)
  09124 Replication and repair
   03420 Nucleotide excision repair
    1642 (DDB1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    1642 (DDB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    1642 (DDB1)
   05161 Hepatitis B
    1642 (DDB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    1642 (DDB1)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    1642 (DDB1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Adoptor protein
     1642 (DDB1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      1642 (DDB1)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      1642 (DDB1)
SSDB
Motif
Pfam: MMS1_N CPSF_A Beta_propel
Other DBs
NCBI-GeneID: 1642
NCBI-ProteinID: NP_001914
OMIM: 600045
HGNC: 2717
Ensembl: ENSG00000167986
Vega: OTTHUMG00000168209
Pharos: Q16531(Tbio)
UniProt: Q16531
Structure
LinkDB
Position
11:complement(61299451..61333105)
AA seq 1140 aa
MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGK
IAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGI
IGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICF
VYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYH
NGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDL
RVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIV
DMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPGIKGLWPLRSDPNRE
TDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVS
QEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVAC
LDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSH
YLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIY
SSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYES
PRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHET
SFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEE
AEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELR
TECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEIL
DDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGET
STPTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTER
KTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH
NT seq 3423 nt   +upstreamnt  +downstreamnt
atgtcgtacaactacgtggtaacggcccagaagcccaccgccgtgaacggctgcgtgacc
ggacactttacttcggccgaagacttaaacctgttgattgccaaaaacacgagattagag
atctatgtggtcaccgccgaggggcttcggcccgtcaaagaggtgggcatgtatgggaag
attgcggtcatggagcttttcaggcccaagggggagagcaaggacctgctgtttatcttg
acagcgaagtacaatgcctgcatcctggagtataaacagagtggcgagagcattgacatc
attacgcgagcccatggcaatgtccaggaccgcattggccgcccctcagagaccggcatt
attggcatcattgaccctgagtgccggatgattggcctgcgtctctatgatggccttttc
aaggttattccactagatcgcgataataaagaactcaaggccttcaacatccgcctggag
gagctgcatgtcattgatgtcaagttcctatatggttgccaagcacctactatttgcttt
gtctaccaggaccctcaggggcggcacgtaaaaacctatgaggtgtctctccgagaaaag
gaattcaataagggcccttggaaacaggaaaatgtcgaagctgaagcttccatggtgatc
gcagtcccagagccctttgggggggccatcatcattggacaggagtcaatcacctatcac
aatggtgacaaatacctggctattgcccctcctatcatcaagcaaagcacgattgtgtgc
cacaatcgagtggaccctaatggctcaagatacctgctgggagacatggaaggccggctc
ttcatgctgcttttggagaaggaggaacagatggatggcaccgtcactctcaaggatctc
cgtgtagaactccttggagagacctctattgctgagtgcttgacataccttgataatggt
gttgtgtttgtcgggtctcgcctgggtgactcccagcttgtgaagctcaacgttgacagt
aatgaacaaggctcctatgtagtggccatggaaacctttaccaacttaggacccattgtc
gatatgtgcgtggtggacctggagaggcaggggcaggggcagctggtcacttgctctggg
gctttcaaggaaggttctttgcggatcatccggaatggaattggaatccacgagcatgcc
agcattgacttaccaggcatcaaaggattatggccactgcggtctgaccctaatcgtgag
actgatgacactttggtgctctcttttgtgggccagacaagagttctcatgttaaatgga
gaggaggtagaagaaaccgaactgatgggtttcgtggatgatcagcagactttcttctgt
ggcaacgtggctcatcagcagcttatccagatcacttcagcatcggtgaggttggtctct
caagaacccaaagctctggtcagtgaatggaaggagcctcaggccaagaacatcagtgtg
gcctcctgcaatagcagccaggtggtggtggctgtaggcagggccctctactatctgcag
atccatcctcaggagctccggcagatcagccacacagagatggaacatgaagtggcttgc
ttggacatcaccccattaggagacagcaatggactgtcccctctttgtgccattggcctc
tggacggacatctcggctcgtatcttgaagttgccctcttttgaactactgcacaaggag
atgctgggtggagagatcattcctcgctccatcctgatgaccacctttgagagtagccat
tacctcctttgtgccttgggagatggagcgcttttctactttgggctcaacattgagaca
ggtctgttgagcgaccgtaagaaggtgactttgggcacccagcccaccgtattgaggact
tttcgttctctttctaccaccaacgtctttgcttgttctgaccgccccactgtcatctat
agcagcaaccacaaattggtcttctcaaatgtcaacctcaaggaagtgaactacatgtgt
cccctcaattcagatggctatcctgacagcctggcgctggccaacaatagcaccctcacc
attggcaccatcgatgagatccagaagctgcacattcgcacagttcccctctatgagtct
ccaaggaagatctgctaccaggaagtgtcccagtgtttcggggtcctctccagccgcatt
gaagtccaagacacgagtgggggcacgacagccttgaggcccagcgctagcacccaggct
ctgtccagcagtgtaagctccagcaagctgttctccagcagcactgctcctcatgagacc
tcctttggagaagaggtggaggtgcacaacctacttatcattgaccaacacacctttgaa
gtgcttcatgcccaccagtttctgcagaatgaatatgccctcagtctggtttcctgcaag
ctgggcaaagaccccaacacttacttcattgtgggcacagcaatggtgtatcctgaagag
gcagagcccaagcagggtcgcattgtggtctttcagtattcggatggaaaactacagact
gtggctgaaaaggaagtgaaaggggccgtgtactctatggtggaatttaacgggaagctg
ttagccagcatcaatagcacggtgcggctctatgagtggacaacagagaaggagctgcgc
actgagtgcaaccactacaacaacatcatggccctctacctgaagaccaagggcgacttc
atcctggtgggcgaccttatgcgctcagtgctgctgcttgcctacaagcccatggaagga
aactttgaagagattgctcgagactttaatcccaactggatgagtgctgtggaaatcttg
gatgatgacaattttctgggggctgaaaatgcctttaacttgtttgtgtgtcaaaaggat
agcgctgccaccactgacgaggagcggcagcacctccaggaggttggtcttttccacctg
ggcgagtttgtcaatgtcttttgccacggctctctggtaatgcagaatctgggtgagact
tccacccccacacaaggctcggtgctcttcggcacggtcaacggcatgatagggctggtg
acctcactgtcagagagctggtacaacctcctgctggacatgcagaatcgactcaataaa
gtcatcaaaagtgtggggaagatcgagcactccttctggagatcctttcacaccgagcgg
aagacagaaccagccacaggtttcatcgacggtgacttgattgagagtttcctggatatt
agccgccccaagatgcaggaggtggtggcaaacctacagtatgacgatggcagcggtatg
aagcgagaggccactgcagacgacctcatcaaggttgtggaggagctaactcggatccat
tag

KEGG   Homo sapiens (human): 8451
Entry
8451              CDS       T01001                                 
Symbol
CUL4A
Name
(RefSeq) cullin 4A
  KO
K10609  cullin 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03420  Nucleotide excision repair
hsa04120  Ubiquitin mediated proteolysis
hsa05170  Human immunodeficiency virus 1 infection
Network
nt06130  Cell cycle (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
  Element
N00456  HIV Vpr to CDC25-cell cycle G2M
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    8451 (CUL4A)
  09124 Replication and repair
   03420 Nucleotide excision repair
    8451 (CUL4A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    8451 (CUL4A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    8451 (CUL4A)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    8451 (CUL4A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8451 (CUL4A)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Cullin
     8451 (CUL4A)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      8451 (CUL4A)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      8451 (CUL4A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   8451 (CUL4A)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 SecA_SW
Other DBs
NCBI-GeneID: 8451
NCBI-ProteinID: NP_001008895
OMIM: 603137
HGNC: 2554
Ensembl: ENSG00000139842
Vega: OTTHUMG00000017384
Pharos: Q13619(Tbio)
UniProt: Q13619
Structure
LinkDB
Position
13:113208193..113267108
AA seq 759 aa
MADEAPRKGSFSALVGRTNGLTKPAALAAAPAKPGGAGGSKKLVIKNFRDRPRLPDNYTQ
DTWRKLHEAVRAVQSSTSIRYNLEELYQAVENLCSHKVSPMLYKQLRQACEDHVQAQILP
FREDSLDSVLFLKKINTCWQDHCRQMIMIRSIFLFLDRTYVLQNSTLPSIWDMGLELFRT
HIISDKMVQSKTIDGILLLIERERSGEAVDRSLLRSLLGMLSDLQVYKDSFELKFLEETN
CLYAAEGQRLMQEREVPEYLNHVSKRLEEEGDRVITYLDHSTQKPLIACVEKQLLGEHLT
AILQKGLDHLLDENRVPDLAQMYQLFSRVRGGQQALLQHWSEYIKTFGTAIVINPEKDKD
MVQDLLDFKDKVDHVIEVCFQKNERFVNLMKESFETFINKRPNKPAELIAKHVDSKLRAG
NKEATDEELERTLDKIMILFRFIHGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLK
HECGAAFTSKLEGMFKDMELSKDIMVHFKQHMQNQSDSGPIDLTVNILTMGYWPTYTPME
VHLTPEMIKLQEVFKAFYLGKHSGRKLQWQTTLGHAVLKAEFKEGKKEFQVSLFQTLVLL
MFNEGDGFSFEEIKMATGIEDSELRRTLQSLACGKARVLIKSPKGKEVEDGDKFIFNGEF
KHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELY
NQLKFPVKPGDLKKRIESLIDRDYMERDKDNPNQYHYVA
NT seq 2280 nt   +upstreamnt  +downstreamnt
atggcggacgaggccccgcggaagggcagcttctcggcgctcgtgggccgcaccaacggc
ctcaccaagcccgcggccctggccgccgcgcccgccaagccggggggcgcgggcggctcc
aagaagctggtcatcaagaacttccgagacagacctcggctgcccgacaactacacgcag
gacacgtggcggaagctgcacgaggcggtgcgggccgtgcagagcagcacctccatcagg
tacaacctcgaggagctctaccaggctgtggaaaatctctgttctcacaaagtctcccca
atgctctacaagcaactgcgtcaggcctgtgaagaccacgtccaggcacagatccttccg
tttagagaagactcactagatagtgttttatttttaaagaagattaacacgtgctggcag
gaccactgcagacaaatgatcatgatcagaagcatcttcctgttcttggaccgcacctat
gtgctgcagaactccacgctgccctccatctgggatatgggattagaactgtttagaacc
catattattagtgataaaatggttcagagtaaaaccattgatggaatcctactgctgatc
gagcgcgagaggagcggcgaggccgtggaccggagcctgttgcggagcctcctgggcatg
ctgtctgacctgcaggtgtataaagattcatttgaactgaaatttttggaagagactaat
tgcttatatgctgccgaaggccaaaggttaatgcaggaaagagaggttccagaatatctt
aaccatgtaagtaaacgcttagaggaagagggagacagagtaatcacttacttggaccac
agcacacagaaaccactgattgcttgtgtggagaaacagctattaggagaacatttaaca
gcaattctgcagaaagggctcgaccacttactggatgagaacagagtgccggacctcgca
cagatgtaccagctgttcagccgggtgaggggcgggcagcaggcgctgctgcagcactgg
agcgagtacatcaagacttttggaacagcgatcgtaatcaatcctgagaaagacaaagac
atggtccaagacctgttggacttcaaggacaaggtggaccacgtgatcgaggtctgcttc
cagaagaatgagcggttcgtcaacctgatgaaggagtcctttgagacgttcatcaacaag
agacccaacaagcctgcagaactgatcgcaaagcatgtggattcaaagttaagagcaggc
aacaaagaagccacagacgaggagctggagcggacgttggacaagatcatgatcctgttc
aggtttatccacggtaaagatgtctttgaagcattttataaaaaagatttggcaaaaaga
ctccttgttgggaaaagtgcctcagtcgatgctgaaaagtctatgttgtcaaagctcaag
catgagtgcggtgcagccttcaccagcaagctggaaggcatgttcaaggacatggagctt
tcgaaggacatcatggttcatttcaagcagcatatgcagaatcagagtgactcaggccct
atagacctcacagtgaacatactcacaatgggctactggccaacatacacgcccatggaa
gtgcacttaaccccagaaatgattaaacttcaggaagtatttaaggcattttatcttgga
aagcacagtggtcgaaaacttcagtggcaaactactttgggacatgctgttttaaaagcg
gagtttaaagaagggaagaaggaattccaggtgtccctcttccagacactggtgctcctc
atgttcaacgagggagatggcttcagctttgaggagataaaaatggccacggggatagag
gatagtgaattgcgcagaacgctgcagtccctggcctgtggcaaagcacgtgtgctgatt
aaaagtcccaaaggaaaggaagtggaagatggagacaagttcatttttaatggagagttc
aagcacaagttgtttagaataaagatcaatcaaattcagatgaaggaaactgttgaggaa
caggttagcaccactgagagagtgtttcaggatagacaatatcagattgatgctgctatc
gtcagaataatgaagatgagaaagactcttggtcataatcttctagtttctgaattatat
aatcagctgaaatttccagtaaagcctggagatttgaaaaagagaattgaatctctgata
gacagagactatatggagagagacaaagacaatccgaatcagtaccactacgtggcctga

KEGG   Homo sapiens (human): 8450
Entry
8450              CDS       T01001                                 
Symbol
CUL4B, CUL-4B, MRXHF2, MRXS15, MRXSC, SFM2
Name
(RefSeq) cullin 4B
  KO
K10609  cullin 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03420  Nucleotide excision repair
hsa04120  Ubiquitin mediated proteolysis
hsa05170  Human immunodeficiency virus 1 infection
Network
nt06130  Cell cycle (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
  Element
N00456  HIV Vpr to CDC25-cell cycle G2M
Disease
H00658  Syndromic X-linked mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    8450 (CUL4B)
  09124 Replication and repair
   03420 Nucleotide excision repair
    8450 (CUL4B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    8450 (CUL4B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    8450 (CUL4B)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    8450 (CUL4B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8450 (CUL4B)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Cullin
     8450 (CUL4B)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      8450 (CUL4B)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      8450 (CUL4B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   8450 (CUL4B)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 SecA_SW
Other DBs
NCBI-GeneID: 8450
NCBI-ProteinID: NP_003579
OMIM: 300304
HGNC: 2555
Ensembl: ENSG00000158290
Vega: OTTHUMG00000022302
Pharos: Q13620(Tbio)
UniProt: Q13620
Structure
LinkDB
Position
X:complement(120523858..120575532)
AA seq 913 aa
MMSQSSGSGDGNDDEATTSKDGGFSSPSPSAAAAAQEVRSATDGNTSTTPPTSAKKRKLN
SSSSSSSNSSNEREDFDSTSSSSSTPPLQPRDSASPSTSSFCLGVSVAASSHVPIQKKLR
FEDTLEFVGFDAKMAEESSSSSSSSSPTAATSQQQQLKNKSILISSVASVHHANGLAKSS
TTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKYNLEEL
YQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQM
IMIRSIFLFLDRTYVLQNSMLPSIWDMGLELFRAHIISDQKVQNKTIDGILLLIERERNG
EAIDRSLLRSLLSMLSDLQIYQDSFEQRFLEETNRLYAAEGQKLMQEREVPEYLHHVNKR
LEEEADRLITYLDQTTQKSLIATVEKQLLGEHLTAILQKGLNNLLDENRIQDLSLLYQLF
SRVRGGVQVLLQQWIEYIKAFGSTIVINPEKDKTMVQELLDFKDKVDHIIDICFLKNEKF
INAMKEAFETFINKRPNKPAELIAKYVDSKLRAGNKEATDEELEKMLDKIMIIFRFIYGK
DVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLKHECGAAFTSKLEGMFKDMELSKDIMI
QFKQYMQNQNVPGNIELTVNILTMGYWPTYVPMEVHLPPEMVKLQEIFKTFYLGKHSGRK
LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR
TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE
RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME
RDKENPNQYNYIA
NT seq 2742 nt   +upstreamnt  +downstreamnt
atgatgtcacagtcatctggatcaggagatgggaatgatgatgaggctactacctctaaa
gacggtggtttttcttcccccagtccctcagctgctgctgctgctcaggaggtcagatct
gccactgatggtaataccagcaccactccgcccacctctgccaagaagagaaagttaaac
agcagcagcagtagcagcagtaacagtagtaacgagagagaagactttgattccacctct
tcctcctcttccactcctcctttacaacccagggattcggcatccccttcaacctcgtcc
ttctgcctgggggtttcagtggctgcttccagccacgtaccgatacagaagaagctgcgt
tttgaagacaccctggagtttgtagggtttgatgcgaagatggctgaggaatcctcctcc
tcctcctcctcatcttcaccaactgctgcaacatctcagcagcagcaacttaaaaataag
agtatattaatctcttctgtggcttcggtgcatcatgcaaacggcctagccaaatcttct
accaccgtctctagctttgctaacagcaaacctggctctgctaagaagttagtgatcaag
aactttaaagataagcctaaattaccagaaaactacacagatgaaacctggcaaaaactg
aaagaagcagtggaagctattcagaatagtacttcaattaagtacaatttagaagaactc
taccaggctgtagaaaatctctgttcttacaagatttctgcaaacttgtacaaacagctg
agacagatctgcgaagatcacatcaaagcacagattcatcaattcagagaggattcattg
gatagcgttctttttttaaagaagattgatagatgctggcaaaaccattgcagacaaatg
atcatgatcaggagcatttttttgtttctggatagaacttacgttcttcagaattcaatg
ctaccctccatttgggacatgggactggagttatttagggctcatattataagtgatcag
aaagtgcagaataagacaattgatggcattcttctcttgattgagagggaaaggaatggt
gaagcaattgatagaagtttacttcgaagccttttaagcatgctgtctgatttgcaaatt
tatcaagattcttttgaacaacgatttttggaagaaactaaccggctctatgcagctgaa
ggccaaaaattaatgcaagaaagagaggttcctgaatatctacatcatgttaacaaacgt
ctagaagaagaagcagacagacttattacttacttagatcagaccacccagaagtcatta
attgctactgtagaaaaacaacttctaggtgaacacttaacagcaattcttcagaaaggt
ttaaataacctccttgatgaaaaccgaattcaagatttgtctcttctgtatcagctcttc
agtagagttcgaggtggagttcaggttcttttgcagcagtggatcgaatatatcaaggca
tttggcagcactattgtaattaatcctgaaaaagataaaaccatggttcaagaattgctg
gattttaaagataaggttgaccatataattgatatctgctttctgaagaatgagaaattt
atcaatgccatgaaagaagcatttgaaacgttcattaacaaaagaccaaataaaccagct
gaacttatagctaagtatgtagattcaaaacttcgtgcaggcaacaaagaagctacagat
gaagaacttgagaaaatgttggataaaattatgatcatatttagatttatctatggcaag
gatgtttttgaggccttctataagaaagatttagccaagcgcctgttagtcggaaagagt
gcatctgtagatgctgaaaaatcaatgctgtccaaacttaaacatgaatgcggagctgct
ttcaccagcaaacttgaaggaatgtttaaagacatggaactttctaaagacatcatgatt
cagttcaaacagtatatgcagaatcagaatgttccgggaaatattgagttaactgtgaat
atcctgacaatgggctattggccgacatatgtgcctatggaagttcatttaccaccagag
atggtaaaacttcaggagattttcaagacattttacctaggcaaacatagtggcaggaaa
cttcagtggcagtcaaccctaggacactgtgtgttaaaagcagaatttaaagagggtaaa
aaggaactccaggtctctctttttcaaacactggtgctgctaatgtttaatgagggagag
gagttcagtttagaagagatcaagcaggcaactggaatagaggatggagagttaaggaga
acactgcagtcattagcctgtggcaaagctagagttctggcgaaaaatccaaagggcaaa
gacattgaagatggtgacaagttcatttgtaatgatgatttcaaacataaacttttcagg
ataaagatcaatcaaatccagatgaaagaaacggttgaagaacaagcaagcactacagaa
agagtatttcaagacagacagtatcaaattgatgctgcaattgttcgaattatgaagatg
agaaagacacttagccacaatctccttgtttcagaagtgtacaaccagttgaaatttcca
gtaaagcctgctgatcttaagaagagaatagaatctttaattgaccgggactacatggaa
agagataaagaaaatccaaaccagtacaactatattgcatag

DBGET integrated database retrieval system