KEGG   Homo sapiens (human): 990
Entry
990               CDS       T01001                                 
Symbol
CDC6, CDC18L, HsCDC18, HsCDC6, MGORS5
Name
(RefSeq) cell division cycle 6
  KO
K02213  cell division control protein 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa05207  Chemical carcinogenesis - receptor activation
Network
nt06230  Cell cycle (cancer)
nt06509  DNA replication
  Element
N01337  NNK/NNN to CHRNA7-E2F signaling pathway
N01468  DNA replication licensing
N01470  Pre-IC formation
Disease
H01889  Meier-Gorlin syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    990 (CDC6)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    990 (CDC6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    990 (CDC6)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    990 (CDC6)
SSDB
Motif
Pfam: Cdc6_C AAA_16 AAA_22 AAA AAA_lid_10 AAA_19 NACHT NB-ARC SLFN-g3_helicase AAA_30 DUF815 NTPase_1 AAA_7 Pox_A32 Zot T2SSE AAA_5 ResIII nSTAND3 Med15_M PIF1 RNA_helicase
Other DBs
NCBI-GeneID: 990
NCBI-ProteinID: NP_001245
OMIM: 602627
HGNC: 1744
Ensembl: ENSG00000094804
UniProt: Q99741
Structure
LinkDB
Position
17:40287879..40304657
AA seq 560 aa
MPQTRSQAQATISFPKRKLSRALNKAKNSSDAKLEPTNVQTVTCSPRVKALPLSPRKRLG
DDNLCNTPHLPPCSPPKQGKKENGPPHSHTLKGRRLVFDNQLTIKSPSKRELAKVHQNKI
LSSVRKSQEITTNSEQRCPLKKESACVRLFKQEGTCYQQAKLVLNTAVPDRLPAREREMD
VIRNFLREHICGKKAGSLYLSGAPGTGKTACLSRILQDLKKELKGFKTIMLNCMSLRTAQ
AVFPAIAQEICQEEVSRPAGKDMMRKLEKHMTAEKGPMIVLVLDEMDQLDSKGQDVLYTL
FEWPWLSNSHLVLIGIANTLDLTDRILPRLQAREKCKPQLLNFPPYTRNQIVTILQDRLN
QVSRDQVLDNAAVQFCARKVSAVSGDVRKALDVCRRAIEIVESDVKSQTILKPLSECKSP
SEPLIPKRVGLIHISQVISEVDGNRMTLSQEGAQDSFPLQQKILVCSLMLLIRQLKIKEV
TLGKLYEAYSKVCRKQQVAAVDQSECLSLSGLLEARGILGLKRNKETRLTKVFFKIEEKE
IEHALKDKALIGNILATGLP
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgcctcaaacccgatcccaggcacaggctacaatcagttttccaaaaaggaagctgtct
cgggcattgaacaaagctaaaaactccagtgatgccaaactagaaccaacaaatgtccaa
accgtaacctgttctcctcgtgtaaaagccctgcctctcagccccaggaaacgtctgggc
gatgacaacctatgcaacactccccatttacctccttgttctccaccaaagcaaggcaag
aaagagaatggtccccctcactcacatacacttaagggacgaagattggtatttgacaat
cagctgacaattaagtctcctagcaaaagagaactagccaaagttcaccaaaacaaaata
ctttcttcagttagaaaaagtcaagagatcacaacaaattctgagcagagatgtccactg
aagaaagaatctgcatgtgtgagactattcaagcaagaaggcacttgctaccagcaagca
aagctggtcctgaacacagctgtcccagatcggctgcctgccagggaaagggagatggat
gtcatcaggaatttcttgagggaacacatctgtgggaaaaaagctggaagcctttacctt
tctggtgctcctggaactggaaaaactgcctgcttaagccggattctgcaagacctcaag
aaggaactgaaaggctttaaaactatcatgctgaattgcatgtccttgaggactgcccag
gctgtattcccagctattgctcaggagatttgtcaggaagaggtatccaggccagctggg
aaggacatgatgaggaaattggaaaaacatatgactgcagagaagggccccatgattgtg
ttggtattggacgagatggatcaactggacagcaaaggccaggatgtattgtacacgcta
tttgaatggccatggctaagcaattctcacttggtgctgattggtattgctaataccctg
gatctcacagatagaattctacctaggcttcaagctagagaaaaatgtaagccacagctg
ttgaacttcccaccttataccagaaatcagatagtcactattttgcaagatcgacttaat
caggtatctagagatcaggttctggacaatgctgcagttcaattctgtgcccgcaaagtc
tctgctgtttcaggagatgttcgcaaagcactggatgtttgcaggagagctattgaaatt
gtagagtcagatgtcaaaagccagactattctcaaaccactgtctgaatgtaaatcacct
tctgagcctctgattcccaagagggttggtcttattcacatatcccaagtcatctcagaa
gttgatggtaacaggatgaccttgagccaagaaggagcacaagattccttccctcttcag
cagaagatcttggtttgctctttgatgctcttgatcaggcagttgaaaatcaaagaggtc
actctggggaagttatatgaagcctacagtaaagtctgtcgcaaacagcaggtggcggct
gtggaccagtcagagtgtttgtcactttcagggctcttggaagccaggggcattttagga
ttaaagagaaacaaggaaacccgtttgacaaaggtgtttttcaagattgaagagaaagaa
atagaacatgctctgaaagataaagctttaattggaaatatcttagctactggattgcct
taa

DBGET integrated database retrieval system