KEGG   Mus caroli (Ryukyu mouse): 110293598
Entry
110293598         CDS       T05910                                 
Symbol
Rimkla
Name
(RefSeq) N-acetylaspartylglutamate synthase A
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00250  Alanine, aspartate and glutamate metabolism
mcal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    110293598 (Rimkla)
Enzymes [BR:mcal01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     110293598 (Rimkla)
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     110293598 (Rimkla)
SSDB
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST ATP-grasp_3 ATP-grasp CPSase_L_D2 Dala_Dala_lig_C Synapsin_C Rimk_N TTL
Other DBs
NCBI-GeneID: 110293598
NCBI-ProteinID: XP_021017140
Ensembl: MGP_CAROLIEiJ_G0026401
UniProt: A0A6P5PPV7
LinkDB
Position
4:complement(110019304..110047383)
AA seq 380 aa
MCAQVWLLTDRLIREDYPQVQILRALRQRCSEQDVGFRAVFLDQIAVTVVGGHLGLQLSQ
KPLTTFPDVVVVRVSTPSVQSDSEITILRHLEKLGCRLVNRPQSILNCINKFWTFQELAG
HGVPMPDTFSYGGHEDFSKMIDEAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLV
RHDVPYLFQKYVKESHGKDIRVVVVGGQVIGSMLRCSTDGRMQSNCFLGGVGVKCPLTEQ
GKQLAIQVSNILGMDFCGIDLLIMDDGSFTVCEANANVGFLAFDQACNLDVGAIIADYAM
SLLPNRQTGKMAILPGLASPREKNEANGCVSAQGVAESVYAITNGSTSSESEPELGEARD
SSVKTMGAPPAHVARAWLQH
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgtgcgcgcaggtctggctgctgaccgaccggctcatccgcgaagactacccgcaggtg
cagatcctgcgcgcgctccgccagcgctgctcggagcaggacgtgggtttccgggcggtg
ttcctggaccagatcgccgtcaccgtcgtcggcggccacctaggcctgcagctgagccag
aaacccctgaccaccttccccgacgtggtggttgttcgagtatccacaccctctgtccaa
tcggatagtgagatcaccatcctgaggcacctggagaagctgggctgccgcttggtcaac
cgtcctcaaagcatcttaaactgcatcaacaagttttggacattccaagagctggctgga
catggggtccccatgccagacaccttctcctatggtgggcacgaagacttctctaaaatg
atcgatgaagctgagcccctgggctacccagtggtggtgaagagcacacgggggcaccgg
gggaaagctgtttttctggccagagacaagcatcacctctctgacatctgccacctagtc
cgccatgatgtgccctacctgtttcagaagtatgtgaaggagtcacacgggaaggacatc
cgggtggtggtggtgggcggccaggtgattggctccatgctgcgctgctccacagatggc
cgcatgcaaagcaactgctttctaggtggtgtgggtgtcaagtgtccactgactgagcaa
ggcaagcagctggctatccaggtgtccaacatcctgggcatggatttctgtggcatcgac
cttcttatcatggatgacggctccttcacggtgtgtgaggccaacgccaatgtcggcttc
ctggccttcgaccaggcatgcaacttagatgtgggggcaatcattgcagactatgctatg
tccctgctgccaaacaggcagactgggaagatggccatcctcccgggactggcaagtccc
agggagaagaacgaggcaaatggttgcgtttcagctcagggagttgcagagagtgtctat
gccatcaccaatgggtctacctctagtgagagtgagcctgaactgggagaggcccgggat
tcctcagtaaaaacaatgggggccccgcctgcgcatgttgcccgagcctggttacagcat
taa

DBGET integrated database retrieval system