KEGG   Oryctolagus cuniculus (rabbit): 100009352
Entry
100009352         CDS       T03373                                 
Symbol
TRPC1, TRPC1A
Name
(RefSeq) transient receptor potential cation channel subfamily C member 1
  KO
K04964  transient receptor potential cation channel subfamily C member 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
ocu04724  Glutamatergic synapse
ocu04726  Serotonergic synapse
ocu04929  GnRH secretion
ocu04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    100009352 (TRPC1)
  09154 Digestive system
   04972 Pancreatic secretion
    100009352 (TRPC1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100009352 (TRPC1)
   04726 Serotonergic synapse
    100009352 (TRPC1)
  09158 Development and regeneration
   04360 Axon guidance
    100009352 (TRPC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ocu04040]
    100009352 (TRPC1)
Ion channels [BR:ocu04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   100009352 (TRPC1)
SSDB
Motif
Pfam: TRP_2 Ion_trans Ank_2 Ank_4 DUF2157
Other DBs
NCBI-GeneID: 100009352
NCBI-ProteinID: NP_001076120
Ensembl: ENSOCUG00000017709
UniProt: Q9TUN9
LinkDB
Position
14:36124862..36213188
AA seq 759 aa
MMAALYPSTDLSGASSSSLPSSPSSSSPNEVMALKDVREVKEENTLNEKLFLLACDKGDY
YMVKKILEENSSGDLNINCVDVLGRNAVTITIENENLDILQLLLDYGCQKLMERIQNPEY
STTMDVAPVILAAHRNNYEILTMLLKQDVSLPKPHAVGCECTLCSAKNKKDSLRHSRFRL
DIYRCLASPALIMLTEEDPILRAFELSADLKELSLVEVEFRNDYEELARQCKMFAKDLLA
QARNSRELEVILNHTSSDEPLDKRGLLEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTV
WFGQMSGYRRKPTCKKIMTVLTVGIFWPVLSLCYLIAPKSQFGRIIHTPFMKFIIHGASY
FTFLLLLNLYSLVYNEDKKNTMGPALERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEES
RNQLSFVMNSLYLATFALKVVAHNKFHDFADRKDWDAFHPTLVAEGLFAFANVLSYLRLF
FMYTTSSILGPLQISMGQMLQDFGKFLGMFLLVLFSFTIGLTQLYDKGYTPKEQKDCVGI
FCEQQSNDTFHSFIGTCFALFWYIFSLAHVAIFVTRFSYGEELQSFVGAVIVGTYNVVVV
IVLTKLLVAMLHKSFQLIANHEDKEWKFARAKLWLSYFDDKCTLPPPFNIIPSPKTICYM
ISSLSKWICSHTSKGKVKRQNSLKEWRNLKQKRDENYQKVMCCLVHRYLTSMRQKMQSTD
QATVENLNELRQDLSKFRNEIRDLLGFRTSKYAMFYPRN
NT seq 2280 nt   +upstreamnt  +downstreamnt
atgatggcggccctgtacccgagtacggacctctcgggcgcctcctcctcctccctgcct
tcctccccatcctcttcgtcgccgaatgaggtgatggcgctgaaggatgtgcgggaggtg
aaggaggagaacaccctgaatgagaagcttttcttgctggcgtgcgacaagggtgactat
tatatggttaaaaagattttggaggaaaacagttcaggtgacttgaacataaattgcgta
gatgtgcttgggagaaatgctgttaccataactattgaaaacgaaaacttggatatactg
cagcttcttttggactacggttgtcagaaactcatggaacggattcagaatcctgagtat
tcaacaactatggatgttgcacctgttattttagctgctcatcgtaacaactatgaaatt
cttacaatgctcttaaaacaggatgtatctctaccaaagccccatgcagttggctgtgaa
tgtacattgtgttctgcaaaaaacaaaaaggatagcctccggcattccaggtttcgtctt
gatatatatcgatgtttggccagtccagctctaataatgttaacagaggaggatccaatt
ctgagagcatttgaacttagtgctgatttgaaagaactaagccttgtggaggtggaattc
aggaatgattatgaggaactagcccggcagtgtaaaatgtttgctaaagatttgcttgca
caagctcggaattcacgtgaattggaagttatcctaaaccacacatctagcgatgagcct
cttgacaaacgggggttactagaagaaagaatgaatttaagtcgtctaaaacttgctatc
aaatataaccaaaaagagtttgtctcccaatctaactgccagcagttcctgaacactgtt
tggtttggacagatgtcaggttaccgacgtaagcccacctgtaagaagataatgactgtt
ttaacagttggcatcttttggccagttttgtcactttgttatttgatagctcccaaatct
caatttggcagaatcattcacacaccgtttatgaaatttattattcatggagcatcatat
ttcacattcctgctgttactaaatctgtactctcttgtctacaatgaggataagaaaaac
acaatggggcctgcccttgaaagaatagactatcttcttatactgtggattattgggatg
atttggtcagacattaaaagactctggtatgaagggttggaagacttcttagaagaatcc
cgtaatcaactcagttttgtcatgaattccctttatttagcaacttttgccctcaaagtg
gttgctcacaacaagtttcatgattttgctgatcgaaaggactgggatgcattccatcct
acgctggtggcagaagggctttttgcatttgcaaatgttctgagttatcttcgtctcttt
tttatgtacacgaccagctctatcttgggtccattacagatttcaatgggacagatgtta
caagattttggaaaatttcttgggatgttcctccttgttttgttttctttcacaattgga
ctgacacaactgtatgataaaggctacactccaaaagaacagaaggactgtgtaggcatc
ttctgtgaacagcaaagcaatgacaccttccactcattcatcggcacttgctttgctttg
ttctggtatattttctccttagcacatgtggcaatctttgtcacaaggtttagttatgga
gaagaattgcagtcctttgttggagctgttattgttggcacatacaatgttgtggtagtg
attgtgcttaccaagctgctggtggccatgcttcataaaagctttcagttgatagcaaat
catgaagacaaagaatggaagtttgctcgagctaagttgtggcttagctactttgatgac
aagtgtacattacccccacctttcaacatcattccttcaccaaagactatctgctatatg
attagtagcctcagtaagtggatttgctctcacacttcaaaaggcaaggtcaaacggcaa
aacagtctaaaggagtggagaaacttgaaacaaaagagagatgagaactaccagaaagtg
atgtgctgtttagtgcaccgttacttgacttccatgagacagaagatgcagagtacagat
caggcaactgtggaaaatctaaatgaactgcgccaagatctctcaaaattccggaatgaa
ataagggatttacttggctttcggacttctaaatatgctatgttttatccaagaaattaa

KEGG   Oryctolagus cuniculus (rabbit): 100009574
Entry
100009574         CDS       T03373                                 
Symbol
TRPC5, TRP5
Name
(RefSeq) transient receptor potential cation channel subfamily C member 5
  KO
K04968  transient receptor potential cation channel subfamily C member 5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
ocu04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    100009574 (TRPC5)
  09158 Development and regeneration
   04360 Axon guidance
    100009574 (TRPC5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100009574 (TRPC5)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ocu04040]
    100009574 (TRPC5)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100009574 (TRPC5)
Ion channels [BR:ocu04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   100009574 (TRPC5)
SSDB
Motif
Pfam: Ion_trans TRP_2 Ank_2 Ank_4 Ank_3 PKD_channel Ank
Other DBs
NCBI-GeneID: 100009574
NCBI-ProteinID: NP_001076248
Ensembl: ENSOCUG00000009245
UniProt: O62852
LinkDB
Position
X:complement(60237397..60560540)
AA seq 974 aa
MAQLYYKKVNYSPYRDRIPLQIVRAETELSAEEKAFLNAVEKGDYATVKQALQEAEIYYN
VNINCMDPLGRSALLIAIENENLEIMELLLNHSVYVGDALLYAIRKEVVGAVELLLSYRK
PSGEKQVPTLMMDTQFSEFTPDITPIMLAAHTNNYEIIKLLVQKRVTIPRPHQIRCNCVE
CVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFKAE
YEELSQQCKLFAKDLLDQARSSRELEIILNHRDDHSEELDPQKYHDLAKLKVAIKYHQKE
FVAQPNCQQLLATLWYDGFPGWRRKHWVVKLLTCMTIGFLFPMLSIAYLISPRSNLGLFI
KKPFIKFICHTASYLTFLFMLLLASQHIVRTDLHVQGPPPTVVEWMILPWVLGFIWGEIK
EMWDGGFTEYIHDWWNLMDFAMNSLYLATISLKIVAYVKYNGSRPREEWEMWHPTLIAEA
LFAISNILSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYF
YYETRAIDEPNNCKGIRCEKQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARHEFTEFV
GATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPP
FNIIPSPKSFLYLGNWFNNTFCPKRDPDGRRRRHNLRSFTERHADSLIQNQHYQEVIRNL
VKRYVAAMIRNSKTNEGLTEENFKELKQDISSFRYEVLDLLGNRKQPRRSLSTSSTELSQ
RDDTNDGSGGARAKSKSVSFNLGCKKKACHGPPLIRTMPRASGAQGKSKAESSSKRSFMG
PSLKKLGLLFSKFNGHMSEPSSEPMYTISDGIVQQHYMWQDIRYSQMEKGKAEACSQSEI
NLSEVELGEVRGAAQSSECPLTCSSSLHCASSICSSNSKLLDSSEDVFETWGEACDLLMH
KWGDGQEEQVTTRL
NT seq 2925 nt   +upstreamnt  +downstreamnt
atggcccaactctactacaaaaaagtcaactactcaccataccgagaccgtatccccctg
cagatcgtgagggctgagacagagctctctgcagaggagaaggccttcctcaatgccgtg
gagaagggggactatgccactgtgaagcaggccctacaggaggccgaaatctactacaat
gtcaacatcaactgcatggaccctttaggccgaagtgctctgctgattgccattgagaat
gagaacttggagatcatggaactgctgctgaaccacagtgtgtacgtgggtgatgcgttg
ctctatgccatccgcaaagaagtagtgggtgctgtggagcttctgctcagctacaggaag
ccaagcggagagaaacaggtgcccactctgatgatggatacccagttctctgagttcaca
ccagacatcactcctattatgctggctgcccacaccaacaactatgaaatcatcaaattg
cttgtccagaaacgagtcacaatcccacggccccaccagatacgctgcaactgtgtggag
tgtgtatccagttctgaagtagacagtctgcgccattctcgctcccgactgaatatctac
aaggctctcgcaagcccctcactcattgccttatcaagcgaggaccccatcctaactgcc
ttccgcctgggctgggagctcaaggagctcagtaaagtggagaatgagttcaaggctgag
tatgaggaactctcccagcagtgcaagctgtttgccaaagacctgctggaccaagcccgg
agctcccgggaactggagatcatcctcaaccacagagatgaccacagtgaagagcttgat
cctcagaagtaccatgatctggctaagctgaaggtggccatcaaataccaccagaaagag
tttgttgctcaacccaactgccaacagttacttgccactctgtggtacgacggcttccct
ggatggcggaggaaacactgggtagtcaagcttctgacctgcatgacaattgggttcctg
tttcccatgctgtctatagcctatctgatctcacccagaagcaacctggggctgttcatc
aagaaaccctttatcaagttcatctgccacacagcatcctatttgaccttcctcttcatg
cttctcctggcttctcagcacatcgtcaggacagacctccatgtgcagggacctccccca
actgtcgtggaatggatgatattgccctgggttctaggttttatttggggggagattaag
gaaatgtgggatggtggatttactgaatacatccatgactggtggaacctgatggatttt
gcaatgaactccctctacttagcaactatttccttgaagattgtggcctatgtcaagtat
aatggttctcggccaagggaggaatgggaaatgtggcacccgactctgattgcagaagca
ctcttcgcaatatccaacattttgagttcattgcgtctcatatccctgttcacagccaac
tctcatttagggcctctgcagatctctttgggacgcatgctgcttgatatcctcaaattc
ctctttatctactgcctggtactgctggcctttgccaatggactgaaccagctttacttt
tattatgagaccagagctatcgatgagcctaacaactgcaaagggatccgatgtgagaaa
cagaacaatgccttctccacgctcttcgaaaccctgcagtcactcttctggtctgtattc
ggccttttaaacctttacgtcaccaatgtgaaagccagacacgagttcactgaatttgtg
ggagctaccatgtttggaacatacaatgtcatctccctggtggtgctgctgaacatgctg
attgcaatgatgaacaattcctaccagcttattgccgatcatgctgatattgagtggaaa
tttgcaaggacaaagctctggatgagttactttgatgaaggtggtaccttgccacctcct
ttcaacatcatccccagccccaagtcatttctataccttggcaactggttcaacaacact
ttctgccccaaaagagaccctgatggtagacggagaaggcacaacttgagaagtttcaca
gaacgccatgctgacagtctgatacaaaatcagcattatcaggaagttatcaggaattta
gttaaaagatatgtggctgcaatgataagaaattccaaaacaaatgaaggactaacagaa
gaaaatttcaaggaactaaagcaggacatctccagctttcgatacgaagtgcttgacctc
ttaggaaatagaaaacagccaaggagaagcctttccactagcagcactgaactctctcag
agggatgataccaatgatggcagtggtggggctcgggccaaatccaagagtgtttctttc
aatttaggctgtaagaaaaaggcatgccatgggccacctctcatcagaaccatgccaaga
gccagtggtgcccaaggaaagtcaaaagccgagtcatcaagcaaacgctccttcatgggc
ccttctctcaagaaattgggtctcctattctccaagtttaatggtcatatgtctgaaccc
agttcagaaccaatgtacaccatttctgatggaatcgttcagcagcactatatgtggcag
gacatcagatattctcagatggagaaagggaaagcagaggcctgttctcaaagtgaaatt
aacctcagtgaggtagaattaggagaagtccggggcgctgctcagagcagtgaatgccct
ttaacctgttccagctctcttcactgtgcatccagcatctgctcctcaaattctaaactc
ttagactcctcagaggatgtatttgaaacttggggagaggcttgtgacttgctcatgcac
aaatggggtgatggacaggaagaacaagttactactcggctctaa

KEGG   Oryctolagus cuniculus (rabbit): 100343668
Entry
100343668         CDS       T03373                                 
Symbol
TRPC3
Name
(RefSeq) transient receptor potential cation channel subfamily C member 3
  KO
K04966  transient receptor potential cation channel subfamily C member 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
ocu05017  Spinocerebellar ataxia
ocu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100343668 (TRPC3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100343668 (TRPC3)
   05022 Pathways of neurodegeneration - multiple diseases
    100343668 (TRPC3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ocu04040]
    100343668 (TRPC3)
Ion channels [BR:ocu04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   100343668 (TRPC3)
SSDB
Motif
Pfam: Ion_trans TRP_2 PKD_channel Ank_2 Ank_4 MCM_N
Other DBs
NCBI-GeneID: 100343668
NCBI-ProteinID: XP_002717302
Ensembl: ENSOCUG00000009487
LinkDB
Position
15:complement(97669853..97759816)
AA seq 921 aa
MSTKVRKCKEQARVTFPAPEEEEEEGEDEGAEPQRRRRGWRGVNGGLEPRSAPLRREPHG
FCPPPFSPGPDLSMEGSPSLRRMTVMREKGRRQAVRGPAFMFNDRGTSLTAEEERFLDAA
EYGNIPVVRKMLEESKTLNVNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARIGDALL
LAISKGYVRIVEAILNHPGFAASKRLTLSPCEQELQDDDFYAYDEDGTRFSPDITPIILA
AHCQKYEVVHMLLLKGARIERPHDYFCKCGDCTEKQRHDSFSHSRSRINAYKGLASPAYL
SLSSEDPVLTALELSNELAKLANIEKEFKNDYRKLSMQCKDFVVGVLDLCRDSEEVEAIL
NGDLESAEPLEVHRHKASLSRVKLAIKYEVKKFVAHPNCQQQLLTIWYENLSGLREQTVA
IKCLVVLVVALGLPFLAIGYWIAPCSRLGKILRSPFMKFVAHAASFIIFLGLLVFNASDR
FEGITTLPNITVIDYPKQIFRVKTTQFTWTEMLIMVWVLGMMWSECKELWLEGPREYILQ
LWNVLDFGMLSIFIAAFTARFLAFLQATKAQQYVDSYVQESDLSEVTLPPEIQYFTYARD
KWLPSDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVLFIMV
FLAFMIGMFILYSYYLGAKVNPAFTTVEESFKTLFWSIFGLSEVTSVVLKYDHKFIENIG
YVLYGIYNVTMVVVLLNMLIAMINSSYQEIEDDSDVEWKFARSKLWLSYFDDGKTLPPPF
SLVPSPKSFVYFIMRIINFSKCRRRRLQKDLEMGIGNSKSRLNLFTQSNSRVFESHSFNS
ILNQPTRYQQIMKRLIKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEDKSQATE
ELAILIHKLSEKLNPSMLRCE
NT seq 2766 nt   +upstreamnt  +downstreamnt
atgtccaccaaggtcaggaagtgcaaggagcaagcgagggtgaccttcccagctccggag
gaggaggaggaagagggcgaggacgaaggcgcggagccgcagcgtcgtcgccggggttgg
agaggcgtcaacggggggctggagccgcgctcggcgcccttgcggcgcgagccgcatggc
ttctgcccgccgcctttctcccccgggccggacctgtccatggagggaagcccatccctg
aggcgcatgacggtgatgcgggagaagggccggcgccaggccgtgcggggcccggccttc
atgttcaacgaccgcggtaccagcctcacggccgaggaggagcgcttcctcgacgcggcc
gagtatggcaacatcccggtggtgcgcaagatgctggaggagtccaagacgctgaacgtc
aactgcgtggactacatgggccagaacgcgctgcagctggccgtgggcaacgagcatctg
gaggtgaccgagctgctactcaagaaggagaacctggcgcgcatcggcgacgccctgctg
ctcgccatcagcaagggctacgtgcgcatcgtagaggccatcctcaaccaccccggcttc
gcggccagcaagcgcctgacgctgagcccctgcgagcaggagctgcaggacgacgacttc
tacgcgtacgacgaggacggcacgcgcttctcgcccgacatcacgcccatcatcctggcg
gcgcactgccagaagtacgaggtggtgcacatgctgctgctcaagggcgccaggatcgag
cggccgcacgattacttctgcaagtgcggggactgcaccgagaagcagaggcatgactcc
ttcagccactcgcgctccaggatcaacgcctacaaggggctggccagcccggcctacttg
tccttgtccagcgaggacccggtgctcacggccctggagctcagcaatgagctggccaaa
ctggccaacatcgagaaggagttcaagaatgactaccggaagctctccatgcaatgcaaa
gactttgtggtgggcgtgctggatctctgccgagactcagaagaggttgaagccattctg
aatggagatctggaatcggcagaacctctggaggtgcacaggcataaagcttcattgagt
cgtgtcaaacttgccattaagtatgaagtcaaaaagtttgtggctcaccccaactgccag
cagcagcttctgaccatctggtatgagaacctgtcgggcctgcgggagcagaccgtggcc
atcaagtgtctggttgtgctggttgtagccttgggcctcccgttcctcgccatcggctac
tggatcgcaccttgcagcaggctggggaaaattctgcgaagcccttttatgaagtttgtg
gcacatgctgcttctttcatcatcttcctgggcctgcttgtgttcaatgcctcagacagg
tttgaaggcatcaccacgctgccaaatatcaccgtcattgactaccccaaacagatcttc
cgggtaaaaaccacccagttcacatggactgaaatgctcattatggtctgggttcttggg
atgatgtggtctgagtgcaaagagctgtggctggaaggaccgagggagtacattttgcag
ttgtggaacgtgctcgactttgggatgctctccattttcattgctgcattcacggccagg
tttctagctttccttcaggcgacaaaagcacagcagtatgtggacagctacgtccaggag
agcgacctcagtgaagttaccctcccgccagagatacagtatttcacctatgctagagat
aaatggctcccttctgaccctcagatcatttctgaaggcctttatgccatagctgttgtg
ctcagcttctctcggatcgcatacatcctccctgcaaatgagagctttggccccttacag
atctctctcggaaggactgtgaaggacatatttaagttcatggtcctctttattatggtg
tttctggcttttatgattggcatgttcatactttattcttactaccttggggctaaagta
aatcctgcttttaccactgtggaagaaagttttaagacgttgttttggtcaatatttggg
ttgtctgaagtgacttctgttgtgctcaaatacgatcacaaattcatagagaatatcgga
tatgttctttatggaatatacaatgtaactatggtggttgttttactcaacatgctaatt
gctatgattaatagctcctatcaagaaattgaggatgacagtgacgtagaatggaagttt
gcccgttcaaaactttggttgtcttattttgatgatgggaaaacattacctccacctttc
agtctagttcctagtccaaaatcatttgtttatttcatcatgcgaatcattaacttttct
aaatgcagaaggagaaggctacagaaggatctagaaatgggaatcggtaactccaaatcc
aggttaaacctcttcactcagtctaactcaagagtttttgaatcacacagttttaacagc
attctcaaccagccaacacgttatcagcagataatgaaaagacttataaaacgatatgtt
ttgaaagcacaagtagacaaagaaaatgatgaagttaatgaaggtgaattgaaagaaatc
aagcaagatatctccagcctgcgttatgaacttttggaagacaagagccaagcaactgag
gaattagccattctcattcataaactcagtgagaaactgaatcccagcatgctgagatgt
gaatga

KEGG   Oryctolagus cuniculus (rabbit): 100347206
Entry
100347206         CDS       T03373                                 
Symbol
TRPC6
Name
(RefSeq) transient receptor potential cation channel subfamily C member 6
  KO
K04969  transient receptor potential cation channel subfamily C member 6
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04022  cGMP-PKG signaling pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100347206 (TRPC6)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100347206 (TRPC6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ocu04040]
    100347206 (TRPC6)
Ion channels [BR:ocu04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   100347206 (TRPC6)
SSDB
Motif
Pfam: Ion_trans TRP_2 PKD_channel Ank_2 Ank_5 Ank_4 ING
Other DBs
NCBI-GeneID: 100347206
NCBI-ProteinID: XP_002708649
UniProt: G1U3E4
LinkDB
Position
1:115172895..115311947
AA seq 929 aa
MTQSPAFGPRRGCPAAAGAGARRNESQDYLLMDSELGDDGCPQLPLPPYAYYPSFRGTDN
RLTHRRQTVLREKGRRLANRGPAYMFSDRSTSLSIEEERFLDAAEYGNIPVVRKMLEECL
SLNVNCVDYMGQNALQLAVANEHLEITELLLKKENLSRVGDALLLAISKGYVRIVEAILN
HPAFAEGRRLATSPSQSELQLDDFYAYDEDGTRFSHDVTPIILAAHCQEYEIVHTLLRKG
ARIERPHDYFCKCSECNQKQKHDSFSHSRSRINAYKGLASPAYLSLSSEDPVMTALELSN
ELAVLANIEKEFKNDYKKLSMQCKDFVVGLLDLCRNTEEVEAILNGDVETRHPGDHGRPN
LSRLKLAIKYEVKKFVAHPNCQQQLLSIWYENLSGLRQQTMAVKFLVVLAVAIGLPFLAL
IYWFAPCSKMGKIMRGPFMKFVAHAASFTIFLGLLVMNAADRFEGTKLLPNETSTDNAKQ
LFRMKTSCFSWMEMLIISWVIGMIWAECKEIWTQGPKEYLFELWNMLDFGMLAIFAASFI
ARFMAFWHASKAQSIIDANDTLKDLTKVTLGDNVKYYNLARIKWDPSDPQIISEGLYAIA
VVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYYIGA
KQNEAFTTVEESFKTLFWAIFGLSEVKSVVINCNHKFIENIGYVLYGVYNVTMVIVLLNM
LIAMINSSFQEIEDDADVEWKFARAKLWFSYFEEGRTLPVPFNLVPSPKSLFYLLLKLKK
WISELFQGHKKGFQEDAEMNKRNEEKKLGILGSHEDLSKLSLDKKQLGHDKQPSIRSSED
FHLNSFNKPPRQYQKIMKRLIKRYVLKAQIDKESDEVNEGELKEIKQDISSLRYELLEEK
SQNTEDLAELIRKLGEKLSLEPNQEESNR
NT seq 2790 nt   +upstreamnt  +downstreamnt
atgacccagagcccggcgttcgggccccggaggggctgccctgccgccgccggagccggc
gcgcggcgcaacgagagccaggactacctgctcatggactcggagctgggagacgacggc
tgcccgcagctcccgctgcctccctacgcctactaccccagcttccggggcactgacaac
agactgacccaccggcggcagacagttctccgtgagaagggaagaaggttggctaaccga
ggaccagcgtacatgtttagtgatcgctccacaagcctatctattgaggaggaacgcttt
ttagatgcagctgaatatggaaacatcccagtggtgaggaagatgttagaggagtgcctg
tcactcaatgtgaactgtgtggattacatgggtcagaatgccctgcagttggcagtggcc
aatgagcacctggaaatcacagagcttcttctcaagaaagaaaacctttctcgggttgga
gatgctttgcttctagctattagtaaaggttacgtccggattgtggaagcaattctcaat
catccagcttttgctgaaggcaggaggttagcaaccagccctagccagtctgaactccag
ctggatgatttttatgcctacgacgaagatgggacccggttctcacatgatgtgactcca
atcatcctggcggcccactgccaggaatatgaaattgttcatacgctcctgcggaagggt
gcccggattgaaaggccccatgattacttctgcaagtgcagtgaatgcaaccagaaacag
aagcacgactcctttagccactccaggtctaggattaatgcctataaaggcctggcgagt
ccggcttacctgtcattgtctagtgaagacccagtcatgacggctttagaacttagcaat
gagctggccgttctggcgaacattgagaaagagttcaagaatgactacaaaaaactctca
atgcagtgcaaagactttgttgttggactccttgatctgtgcagaaatactgaagaagtc
gaggccattctgaatggggatgttgaaacacgccaccctggtgaccatggtcgtccaaat
ctcagccgtttaaaacttgccattaaatacgaagtaaaaaaatttgtagctcatccaaac
tgccaacagcagctcctctccatatggtacgagaatctctccgggttgcggcagcagacg
atggcagtcaagttcctcgtggtccttgccgttgccattggactgccctttctggctctc
atttactggtttgctccatgcagcaagatggggaagataatgcgtggaccattcatgaag
tttgtagcacacgcagcttccttcaccatttttctgggactgctagttatgaacgcagct
gacagatttgaaggcaccaaactccttcctaatgaaaccagcacagataatgcaaaacag
ctgttcaggatgaaaacatcctgcttctcatggatggagatgctcattatttcctgggta
ataggcatgatatgggctgaatgtaaagaaatctggactcaaggccccaaggaatactta
tttgagttgtggaatatgcttgattttggtatgttagcgatatttgcagcatcatttatt
gcaagattcatggcattttggcatgcttctaaagctcagagcatcattgatgcaaatgat
actttgaaggacttgacaaaagttaccttgggagacaatgtgaaatactacaatttggct
aggattaagtgggacccctctgatcctcaaattatatctgaaggactttatgcaattgct
gtagttttgagtttctccagaatagcttatattttgccagcaaatgaaagttttggacct
ctgcagatatcacttggaagaacagtaaaagacatcttcaagttcatggtcatattcatc
atggtgtttgtggcttttatgattggaatgttcaacctctactcctactacattggtgca
aaacaaaatgaagcatttacaacagttgaggagagttttaagacactgttttgggctata
tttggactttctgaggtgaaatcagtggtgatcaactgtaatcacaaattcattgaaaac
atcggttatgttctttatggagtctataatgttacgatggtcattgttttgctaaatatg
ttaattgcaatgatcaacagttcattccaggaaattgaggatgatgctgatgttgagtgg
aaatttgcgagggccaaactttggttttcctactttgaagaggggagaacacttcctgtt
cccttcaacctggtgccaagtccaaagtccctgttttatctcttactgaagcttaaaaaa
tggatatctgaactgttccagggtcataaaaaaggtttccaagaggatgcagagatgaac
aagagaaatgaagaaaagaaacttggaattttaggaagtcacgaagacctctcaaaatta
tcacttgacaaaaaacagcttggccatgacaagcaaccaagtataagaagttcagaagat
ttccatttaaatagtttcaataagcctccaagacagtatcagaaaataatgaagaggctc
attaagagatacgtcctgaaagcccagatagacaaggagagcgacgaagtgaatgaaggg
gaactgaaggagattaagcaagacatctctagtctccgctatgaactccttgaagaaaag
tctcagaatacagaagatctagcagaacttattagaaaacttggggagaagttatccttg
gaaccaaatcaagaggaaagcaatagataa

KEGG   Oryctolagus cuniculus (rabbit): 100353818
Entry
100353818         CDS       T03373                                 
Symbol
TRPC4
Name
(RefSeq) transient receptor potential cation channel subfamily C member 4
  KO
K04967  transient receptor potential cation channel subfamily C member 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
ocu04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    100353818 (TRPC4)
  09158 Development and regeneration
   04360 Axon guidance
    100353818 (TRPC4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ocu04040]
    100353818 (TRPC4)
Ion channels [BR:ocu04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   100353818 (TRPC4)
SSDB
Motif
Pfam: Ion_trans TRP_2 Ank_4 Ank_2 Ank_3 Ank PKD_channel Ank_5
Other DBs
NCBI-GeneID: 100353818
NCBI-ProteinID: XP_002721133
Ensembl: ENSOCUG00000012256
LinkDB
Position
Un
AA seq 977 aa
MAQFYYKRNVNAPYRDRIPLRIVRAESELSPSEKAYLNAVEKGDYASVKKSLEEAEIYFK
ININCIDPLGRTALLIAIENENLELIELLLSFNVYVGDALLHAIRKEVVGAVELLLNHKK
PSGEKQVPPILLDKQFSEFTPDITPIILAAHTNNYEIIKLLVQKGVSVPRPHEVRCNCVE
CVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSE
YEELSRQCKQFAKDLLDQTRSSRELEIILNYRDDNSLIEEQSGNDLARLKLAIKYRQKEF
VAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIIGLLFPVFSVCYLIAPKSPLGLFIR
KPFIKFICHTASYLTFLFLLLLASQHIDRSDLNRQGPPPTIVEWMILPWVLGFIWGEIKQ
MWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAFVKYSALNPRESWDMWHPTLVAEAL
FAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFY
YEETKGLSCKGIRCEKQNNAFSTLFETLQSLFWSIFGLINLYVTNVKAQHEFTEFVGATM
FGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNVI
PSPKSLWYLIKWIWTHLCKKKMRRKPESFGTIGRRAADNLRRHHQYQEVMRNLVKRYVAA
MIRDAKTEEGLTEENFKELKQDISSFRFEVLGLLRGSKLSTIQSANAAKEASNSADSDEK
SDNEGNSKDKKKNFSLFDLTTLIHPRSAAIASERHNISNGSALVVQEPPREKQRKVNFVT
DIKNFGLFHRRSKQNAAEQNANQIFSVSEEVARQQAAGPLERNIQLESRGLVSRGDLNIP
GLSEQCVLVDHRERNTDSLGLQVGKRTCSFESDKVVVEDTVPIIPKEKHSKEEDSSIDYD
LNLTDTVTHEDYVTTRL
NT seq 2934 nt   +upstreamnt  +downstreamnt
atggctcagttttattacaaaagaaatgttaatgctccctacagagaccgcatccctctg
aggatagtaagagcagaatcagaactctcaccatcagaaaaagcctatttgaatgcggta
gaaaaaggagattatgcaagtgtcaagaaatctctagaggaagctgaaatttatttcaaa
atcaatattaattgcattgatcctcttggaagaactgctctcctcattgccattgaaaat
gagaacttggagctcattgaactgctgttaagctttaatgtttatgttggagatgctctg
ttacatgcaatcagaaaagaagtcgtcggagctgttgagctgttattgaaccacaaaaag
ccaagtggagaaaaacaggtgcctcctatactgcttgataagcaattctctgaattcact
ccggacatcacaccaatcattttggcagcccatacaaataattatgagataataaaactt
ttggttcagaaaggagtctcggtgccccgaccccatgaggttcgttgtaactgtgtagaa
tgtgtctccagttcagatgtggacagcctccgtcactcacgctccagactcaacatctac
aaggccttggccagcccctcgctcattgcactgtcaagtgaagatccttttctcacagcc
tttcagctaagttgggaacttcaagaactgagtaaggtagaaaatgaattcaagtcagag
tatgaggagctgtcacgacagtgcaaacagtttgcaaaggacctcttggatcagacaaga
agttccagagaactggaaatcattcttaattaccgagatgacaatagtttgatagaagag
caaagtggaaatgatcttgcaagactaaaattggccattaagtaccgtcaaaaggagttt
gttgcccagcccaattgtcaacagctgctcgcatctcgctggtatgatgaatttcctggc
tggaggaggagacattgggcagtgaagatggtgacatgtttcataataggactgcttttc
cctgtcttctccgtgtgctacctgatagctcctaaaagtccgctgggactgttcatcaga
aagccatttatcaagtttatctgccacacagcctcctatttgacttttttgttcctcctg
ctgcttgcctctcagcacatcgacaggtcagacttgaacaggcaaggtccaccaccaacc
atcgtcgaatggatgatattaccatgggtcctgggtttcatatggggagaaattaagcag
atgtgggacggcggacttcaagattatatccatgattggtggaatctaatggattttgtg
atgaattctttatacttagcaacaatctccttgaaaattgtcgcatttgtaaagtacagt
gctcttaatccacgagaatcttgggacatgtggcatcccactctggtggctgaggcttta
tttgctattgcaaacatcttcagttccttgcgtctgatctcactatttactgcaaattct
catctgggacctctgcaaatatctctgggaagaatgctcctggacattttgaagtttctg
ttcatatactgccttgtgttactagcatttgcaaatggccttaatcaattgtacttctat
tatgaagaaacgaaagggttaagctgcaaaggcatacgatgtgaaaagcagaataatgca
ttttcaacgttatttgagacacttcaatccctgttttggtcaatatttgggctcatcaat
ttatatgtgaccaatgttaaagcccagcatgaattcactgagtttgttggtgccaccatg
tttgggacatacaatgtcatctctctagttgtcttactcaacatgttaatagctatgatg
aataattcttaccaacttattgctgaccatgcagatatagaatggaaatttgctcgaaca
aagctttggatgagttactttgaagaaggaggtactctgcctactcccttcaatgtcatc
ccaagtcccaagtccctctggtacctgatcaagtggatatggacacatctgtgcaagaaa
aagatgagaagaaaaccagagagttttggaacaatagggaggagagctgctgataatttg
aggcgacatcaccaatatcaagaagttatgaggaacctggtgaagcgatacgttgctgca
atgattagagacgctaaaactgaagaaggcctcactgaagaaaacttcaaggaactaaaa
caagacatttctagtttccgctttgaagttctgggattactaagaggaagcaaactttcc
acaatacaatcggcaaatgccgcgaaggaggcttctaactcagctgactcagatgaaaag
agtgataacgaaggtaatagcaaagacaagaaaaagaatttcagccttttcgatttaacc
accctgattcatccaagatcagcagcaattgcctctgaacgacataacataagcaatggc
tctgccctggtggtgcaggaaccaccgagggagaagcagagaaaagtgaattttgtgacc
gatatcaaaaacttcgggttatttcatagacggtcaaagcaaaacgctgctgagcaaaac
gcaaaccaaatcttctctgtttcagaagaagttgctcgtcaacaggctgcaggaccactt
gagagaaatattcaactggaatcccgaggattagtgtcacggggtgatctgaacattcct
ggtctcagtgaacagtgtgtgttagtagaccatagagaaaggaacacggactcactgggt
ttacaggtaggcaagagaacgtgttcattcgagtcagacaaggtggtggtggaggacact
gttcccattataccaaaggagaagcactcaaaggaagaggattctagcatagactatgac
ttaaacctcaccgacacagtcacccatgaagattacgtgacaacgagattgtga

DBGET integrated database retrieval system