KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336560
Entry
4336560           CDS       T01015                                 
Name
(RefSeq) dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase isoform X1
  KO
K03847  alpha-1,6-mannosyltransferase [EC:2.4.1.260]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa00513  Various types of N-glycan biosynthesis
osa01100  Metabolic pathways
Module
osa_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4336560
   00513 Various types of N-glycan biosynthesis
    4336560
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4336560
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.260  dolichyl-P-Man:Man7GlcNAc2-PP-dolichol alpha-1,6-mannosyltransferase
     4336560
Glycosyltransferases [BR:osa01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   4336560
SSDB
Motif
Pfam: Glyco_transf_22 PMT_2
Other DBs
NCBI-GeneID: 4336560
NCBI-ProteinID: XP_015633404
LinkDB
Position
4:complement(27275217..27282775)
AA seq 503 aa
MAPPRPSPAARLLREYGWDLLLGSIAAFYAVMVPYTKVEESFNVQAMHDILYHNYHIEKY
DHLEFPGVVPRSFIGALVVSVISSPAVFVMHLCHVPKVYGLLAVRIVLGSIILMTLRLLR
VQFISDIQVKRKFGHHAEAFYLILTATQFHLLFYSTRPLPNVLALAFVNLTYYFWFKGNH
RRTLQALIVAAVIFRCDMILLLGTIGLALLLSRSISLLEAIKCCVSTAIICIGFTVLVDS
ILWRRILWPEFEVLWFNSVLNRSSEWGTHSIHWYFTSALPRSMLVAYPLCMVGALLDRRI
VPYILPVFSFVVLYSKLPHKELRFIMASIPMLNVSASLAASRIYNNRKKTGWKLLYVLMI
GGFLSSLGYSGVTFMASYNNYPGGYALKALHEADSVMKDKIVHIDAFTAMSGVSRFCESE
YPWRYSKEEKISIEEYQERNFTYLLNEHRHISGYKCLFAVDGFSRAKIQPRIPLLSLVKE
PKVFAHGNTRDPDILSLNWPGCP
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggcgccgccgcggccctcgccggcggcgaggctgctgagggagtacgggtgggacctg
ttgctcggatcgattgccgcgttctacgccgtcatggtgccctacaccaaggtggaagag
agcttcaacgtgcaggccatgcatgacattctctaccacaactatcatattgagaagtat
gatcatttagaatttcctggtgttgtccctcggtcatttataggagcattggttgtatct
gttatctcatcgcctgcagtcttcgtaatgcatttatgtcatgttccaaaggtttatggt
cttctagcagttcggatagtgttgggtagtattatcctgatgactttgagacttctccga
gttcagttcatttctgatatacaggtaaaaaggaagtttggtcatcatgctgaagcattc
tatctgatactaactgctacccagtttcacttattgttctactcaaccaggccccttccg
aatgtcttagctttagcttttgttaacttgacatactatttctggttcaagggaaaccat
cgacgcacattacaggccctgattgtcgcagcagttatttttaggtgtgacatgattttg
cttcttggtacaataggacttgcacttttgctgagcaggtctatttctctattggaagca
atcaaatgttgtgtaagcactgccattatatgcattggcttcactgtactggttgactct
atactgtggcggcgaatcctgtggccagaatttgaggttttgtggtttaattcagttctg
aaccggagttcagagtggggtacacattccatccattggtacttcacctcagcacttcca
cgctccatgctggtagcatatcctctttgcatggtcggtgctcttcttgacagaaggata
gtgccatacatacttccagtcttctcatttgttgtgctttattcaaagcttccacataag
gagcttcgcttcattatggcttcgattcccatgcttaatgtgtctgcttcactagcagca
agcagaatatataataacagaaagaaaactgggtggaagttactttatgttctcatgatt
ggtggctttctttccagtctaggatactctggtgtaactttcatggcatcctacaataat
tatcctggtggatatgctctaaaggctctacatgaagcagattctgtaatgaaggacaaa
attgttcacattgatgccttcactgcaatgagtggagtttcacgtttctgtgaaagtgaa
tatccttggagatattctaaggaggaaaaaatttccatcgaggaatatcaggaaagaaat
ttcacatatctgctgaatgaacaccgccatatcagtggctacaagtgcttgtttgccgtg
gatggattctccagagcgaaaattcaacctcgaatcccactactctcactggtgaaagag
ccaaaagtgtttgcacatgggaatacgagagaccctgatattctttcgctgaattggccc
ggttgcccttga

DBGET integrated database retrieval system