KEGG   Plasmodium berghei: PBANKA_1126700
Entry
PBANKA_1126700    CDS       T01111                                 

Definition
(RefSeq) 6-pyruvoyltetrahydropterin synthase, putative
  KO
K22101  dihydroneopterin triphosphate aldolase (PTPS-III) / 6-pyruvoyltetrahydropterin synthase [EC:4.1.2.60 4.2.3.12]
Organism
pbe  Plasmodium berghei
Pathway
pbe00790  Folate biosynthesis
pbe01100  Metabolic pathways
pbe01240  Biosynthesis of cofactors
Module
pbe_M00841  Tetrahydrofolate biosynthesis, mediated by PTPS, GTP => THF
Brite
KEGG Orthology (KO) [BR:pbe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PBANKA_1126700
Enzymes [BR:pbe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.60  dihydroneopterin triphosphate aldolase
     PBANKA_1126700
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.12  6-pyruvoyltetrahydropterin synthase
     PBANKA_1126700
SSDB
Motif
Pfam: PTPS Trehalase_Ca-bi Imm63
Other DBs
NCBI-GeneID: 55150633
NCBI-ProteinID: XP_034422474
LinkDB
Position
11
AA seq 172 aa
MSNDLFKSENNIAELLVESPAFTFHCAHFIAYKGFRETLHGHNYNVSLKVKGHIQNDGYV
VDFSILKKIVKNICNTIDHRFIIPTNSDVLKIEKINNNFQITCEDNSVYSFPQNDCVEIP
IKHSSTEEIGHYILNKVIDAIGMDFLKSRSVTYIEISVSESLTQKAIVCRYI
NT seq 519 nt   +upstreamnt  +downstreamnt
atgagcaacgatttatttaagtcagaaaataatatagcagaacttttagttgaatcacca
gcatttacatttcattgtgctcattttattgcttataaaggattcagagaaacattacat
ggtcataattataatgtttcgttaaaagtgaaaggacatatacaaaatgatggatatgtt
gtagatttttctatattaaaaaagattgttaaaaacatttgcaatacaatagaccatcgt
tttattatacccactaacagtgacgttctaaaaatcgagaaaataaataataattttcaa
attacgtgtgaagataattctgtatattcatttccacaaaatgattgtgttgaaattcct
ataaagcattcatcgactgaagaaataggccattacattcttaacaaagtaatagatgca
ataggcatggatttccttaaaagtcggtcagttacttatatagagataagtgtgagtgaa
tcgctaacacaaaaagcgatagtttgcaggtatatataa

DBGET integrated database retrieval system