KEGG   Plasmodium falciparum 3D7: PF3D7_0628000
Entry
PF3D7_0628000     CDS       T00095                                 

Definition
(RefSeq) 6-pyruvoyltetrahydropterin synthase
  KO
K22101  dihydroneopterin triphosphate aldolase (PTPS-III) / 6-pyruvoyltetrahydropterin synthase [EC:4.1.2.60 4.2.3.12]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
pfa00790  Folate biosynthesis
pfa01100  Metabolic pathways
pfa01240  Biosynthesis of cofactors
Module
pfa_M00841  Tetrahydrofolate biosynthesis, mediated by PTPS, GTP => THF
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PF3D7_0628000
Enzymes [BR:pfa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.60  dihydroneopterin triphosphate aldolase
     PF3D7_0628000
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.12  6-pyruvoyltetrahydropterin synthase
     PF3D7_0628000
SSDB
Motif
Pfam: PTPS
Other DBs
NCBI-GeneID: 3885700
NCBI-ProteinID: XP_966263
PlasmoDB: PFF1360w
GeneDB: PFF1360w
UniProt: C6KTB6
LinkDB
Structure
PDB: 
1Y13

Position
6:1121690..1122211
AA seq 173 aa
MMKEETLNSDNSSAEVSVESPSFSFNCAHFIAYNGFRETLHGHNYNVSLKVRGYVRDDGY
VIDFSILKEKVKKVCNKLDHHFILPIYSDVLKFENVKNNIKIICEDNSEYSFPERDCIKL
PIKHSSTEEIGQYILNQLIEEMDVSLLKSRHIHYIEISVSESPTQKAIVHKYI
NT seq 522 nt   +upstreamnt  +downstreamnt
atgatgaaagaggaaaccctaaattcagataacagttctgctgaagtttctgtggagtca
ccttctttttcatttaattgtgcacattttatagcatacaatggttttcgagaaacctta
catggtcataattataacgtctctttaaaagttcgaggatatgtcagagatgatggatat
gtaatagatttttccatattaaaagaaaaagtaaaaaaagtgtgtaataaattagatcat
cattttatattacctatatatagtgatgtgttaaaatttgaaaatgtaaaaaataatata
aaaatcatatgtgaagataattcagaatattctttcccagaaagagattgtataaaactt
cctattaaacattcttctactgaagaaattggacaatacattcttaaccaactaatagaa
gaaatggatgtttcccttttaaaatcaagacatatacattatatagaaataagtgtcagt
gaatcacctacacaaaaggccatagtccacaaatatatataa

DBGET integrated database retrieval system