KEGG   Pan troglodytes (chimpanzee): 748944
Entry
748944            CDS       T01005                                 
Symbol
RIMKLA
Name
(RefSeq) N-acetylaspartylglutamate synthase A
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00250  Alanine, aspartate and glutamate metabolism
ptr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    748944 (RIMKLA)
Enzymes [BR:ptr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     748944 (RIMKLA)
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     748944 (RIMKLA)
SSDB
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST ATP-grasp_3 ATP-grasp Dala_Dala_lig_C CPSase_L_D2 Rimk_N Synapsin_C TTL
Other DBs
NCBI-GeneID: 748944
NCBI-ProteinID: XP_001164308
Ensembl: ENSPTRG00000000607
VGNC: 11886
UniProt: A0A6D2W5W1 H2PYT3
LinkDB
Position
1:41188342..41231598
AA seq 391 aa
MCSQLWFLTDRRIREDYPQVQILRALRQRCSEQDVRFRAVLMDQIAVTIVGGHLGLQLNQ
KALTTFPDVVLVRVPTPSVQSDSDITVLRHLEKLGCRLVNRPQSILNCINKFWTFQELAG
HGVPMPDTFSYGGHEDFSKMIDEAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLI
RHDVPYLFQKYVKESHGKDIRVVVVGGQVIGSMLRCSTDGRMQSNCSLGGVGVKCPLTEQ
GKQLAIQVSNILGMDFCGIDLLIMDDGSFVVCEANANVGFLAFDQACNLDVGGIIADYTM
SLLPNRQTGKMAVLPGLSSPREKNEPDGCASAQGVAESVYTINSGSTSSESEPELGEIRD
SSASTMGAPPSMLPEPGYNINNRIASELKLK
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgtgctcccagctctggttcctgaccgaccggcgcatccgcgaggactacccgcaggtg
cagatcctgcgcgccctccggcagcgctgctccgagcaggacgtgcgcttccgggcggtg
cttatggaccagatcgccgtcaccatcgtcggcggccacctcggcctccagctaaaccag
aaggccctcaccaccttcccggatgtggtgcttgtacgggtacccacaccctcagtgcag
tcagacagtgacatcactgtcctgcgacacctggagaagctgggctgccggttggtcaat
cgcccacagagcatcttaaattgcatcaacaaattctggacgttccaagaactggctgga
catggggtccccatgccagacaccttctcctatggtgggcatgaagacttttcaaaaatg
attgatgaagctgagcccctgggctacccagtcgtggtgaagagcacacgaggccaccgg
ggaaaagctgtttttctggcaagagataaacatcacctctctgacatctgccatctgatc
cgccacgatgtgccctacctgttccagaagtacgtgaaggagtcccatggaaaggacatc
cgggtggtggtggtagggggccaggtcataggctctatgcttcgctgctccactgacgga
cggatgcagagcaactgctctctcggtggcgtgggcgtcaagtgtccgctgacagaacaa
ggcaagcagttggctattcaggtgtccaacatcctaggcatggacttctgtggcattgat
ctccttatcatggacgatggctcctttgtggtgtgtgaggcaaatgctaatgtcggcttc
ctagccttcgaccaggcatgcaacttagatgtgggtgggatcattgcagactataccatg
tccttgctgccaaataggcagactggaaagatggctgtcctcccaggactgtcgagtccg
agggagaagaacgagccggatggctgtgcttcagctcagggagttgcagagagcgtctat
accatcaacagtgggtctacctctagcgaaagtgagcctgaactgggagagatccgggat
tcctcagcaagcacaatgggggccccaccctccatgctgcccgaacctggctacaacatt
aacaacaggattgcttctgagttaaaacttaagtga

DBGET integrated database retrieval system