KEGG   Homo sapiens (human): 1230
Entry
1230              CDS       T01001                                 

Gene name
CCR1, CD191, CKR-1, CKR1, CMKBR1, HM145, MIP1aR, SCYAR1
Definition
(RefSeq) C-C motif chemokine receptor 1
  KO
K04176  C-C chemokine receptor type 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa05163  Human cytomegalovirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
  Element
N00212  KSHV vCCL2 to CCR signaling pathway
N01166  CCL3/5/7/8/13/14/15/16/23 to CCR1 signaling
N01170  KSHV vCCL2 to CCR1 signaling
N01171  MOCV1 MC148 to CCR1 signaling
N01172  HHV6A vCCL4a to CCR1 signaling
Disease
H01360  Allergic rhinitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1230 (CCR1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    1230 (CCR1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    1230 (CCR1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    1230 (CCR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    1230 (CCR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1230 (CCR1)
   04050 Cytokine receptors [BR:hsa04050]
    1230 (CCR1)
   04090 CD molecules [BR:hsa04090]
    1230 (CCR1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    1230 (CCR1)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CC Chemokine
   1230 (CCR1)
CD molecules [BR:hsa04090]
 Proteins
  1230 (CCR1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx DUF1240
Other DBs
NCBI-GeneID: 1230
NCBI-ProteinID: NP_001286
OMIM: 601159
HGNC: 1602
Ensembl: ENSG00000163823
Vega: OTTHUMG00000133451
Pharos: P32246(Tchem)
UniProt: P32246 Q5U003
LinkDB
Position
3p21.31
AA seq 355 aa
METPNTTEDYDTTTEFDYGDATPCQKVNERAFGAQLLPPLYSLVFVIGLVGNILVVLVLV
QYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLKDDWVFGDAMCKILSGFYYTGLYSE
IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTH
HTCSLHFPHESLREWKLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRL
IFVIMIIFFLFWTPYNLTILISVFQDFLFTHECEQSRHLDLAVQVTEVIAYTHCCVNPVI
YAFVGERFRKYLRQLFHRRVAVHLVKWLPFLSVDRLERVSSTSPSTGEHELSAGF
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggaaactccaaacaccacagaggactatgacacgaccacagagtttgactatggggat
gcaactccgtgccagaaggtgaacgagagggcctttggggcccaactgctgccccctctg
tactccttggtatttgtcattggcctggttggaaacatcctggtggtcctggtccttgtg
caatacaagaggctaaaaaacatgaccagcatctacctcctgaacctggccatttctgac
ctgctcttcctgttcacgcttcccttctggatcgactacaagttgaaggatgactgggtt
tttggtgatgccatgtgtaagatcctctctgggttttattacacaggcttgtacagcgag
atctttttcatcatcctgctgacgattgacaggtacctggccatcgtccacgccgtgttt
gccttgcgggcacggaccgtcacttttggtgtcatcaccagcatcatcatttgggccctg
gccatcttggcttccatgccaggcttatacttttccaagacccaatgggaattcactcac
cacacctgcagccttcactttcctcacgaaagcctacgagagtggaagctgtttcaggct
ctgaaactgaacctctttgggctggtattgcctttgttggtcatgatcatctgctacaca
gggattataaagattctgctaagacgaccaaatgagaagaaatccaaagctgtccgtttg
atttttgtcatcatgatcatcttttttctcttttggaccccctacaatttgactatactt
atttctgttttccaagacttcctgttcacccatgagtgtgagcagagcagacatttggac
ctggctgtgcaagtgacggaggtgatcgcctacacgcactgctgtgtcaacccagtgatc
tacgccttcgttggtgagaggttccggaagtacctgcggcagttgttccacaggcgtgtg
gctgtgcacctggttaaatggctccccttcctctccgtggacaggctggagagggtcagc
tccacatctccctccacaggggagcatgaactctctgctgggttctga

KEGG   Homo sapiens (human): 1234
Entry
1234              CDS       T01001                                 

Gene name
CCR5, CC-CKR-5, CCCKR5, CCR-5, CD195, CKR-5, CKR5, CMKBR5, IDDM22
Definition
(RefSeq) C-C motif chemokine receptor 5
  KO
K04180  C-C chemokine receptor type 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04144  Endocytosis
hsa05145  Toxoplasmosis
hsa05163  Human cytomegalovirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05203  Viral carcinogenesis
Network
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00212  KSHV vCCL2 to CCR signaling pathway
N00428  CCR5-GNB/G-PLCB/G-PKC signaling pathway
N00431  HIV gp120 to CXCR4-GNAI-PI3K-BAD signaling pathway
N00432  HIV gp120 to CXCR4-GNAQ-PLCB/G-calcineurin
N00434  HIV gp120 to CXCR4-GNB/G-RAC signaling pathway
N01196  CCL3/4/5/8 to CCR5 signaling
N01206  KSHV vCCL2 to CCR5 signaling
N01208  MOCV1 MC148 to CCR5 signaling
N01209  HHV6A vCCL4a to CCR5 signaling
N01210  KSHV vCCL1 to CCR5 signaling
N01211  HIV gp120 to CCR5 signaling
Disease
H01360  Allergic rhinitis
Drug target
Ancriviroc: D03210
Aplaviroc hydrochloride: D06557
Cenicriviroc (DG01264): D09878 D09879
Leronlimab: D11399
Maraviroc: D06670<JP/US>
Vicriviroc maleate: D06297
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1234 (CCR5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    1234 (CCR5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    1234 (CCR5)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    1234 (CCR5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    1234 (CCR5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    1234 (CCR5)
   05163 Human cytomegalovirus infection
    1234 (CCR5)
   05167 Kaposi sarcoma-associated herpesvirus infection
    1234 (CCR5)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    1234 (CCR5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1234 (CCR5)
   04050 Cytokine receptors [BR:hsa04050]
    1234 (CCR5)
   04090 CD molecules [BR:hsa04090]
    1234 (CCR5)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    1234 (CCR5)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CC Chemokine
   1234 (CCR5)
CD molecules [BR:hsa04090]
 Proteins
  1234 (CCR5)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx T4SS_pilin
Other DBs
NCBI-GeneID: 1234
NCBI-ProteinID: NP_000570
OMIM: 601373
HGNC: 1606
Ensembl: ENSG00000160791
Vega: OTTHUMG00000133481
Pharos: P51681(Tclin)
UniProt: P51681 Q38L21
LinkDB
Structure
PDB: 
6MEO 6MET 6FGP 2L87

Position
3p21.31
AA seq 352 aa
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKR
LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII
LLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSS
HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI
MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV
GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggattatcaagtgtcaagtccaatctatgacatcaattattatacatcggagccctgc
caaaaaatcaatgtgaagcaaatcgcagcccgcctcctgcctccgctctactcactggtg
ttcatctttggttttgtgggcaacatgctggtcatcctcatcctgataaactgcaaaagg
ctgaagagcatgactgacatctacctgctcaacctggccatctctgacctgtttttcctt
cttactgtccccttctgggctcactatgctgccgcccagtgggactttggaaatacaatg
tgtcaactcttgacagggctctattttataggcttcttctctggaatcttcttcatcatc
ctcctgacaatcgataggtacctggctgtcgtccatgctgtgtttgctttaaaagccagg
acggtcacctttggggtggtgacaagtgtgatcacttgggtggtggctgtgtttgcgtct
ctcccaggaatcatctttaccagatctcaaaaagaaggtcttcattacacctgcagctct
cattttccatacagtcagtatcaattctggaagaatttccagacattaaagatagtcatc
ttggggctggtcctgccgctgcttgtcatggtcatctgctactcgggaatcctaaaaact
ctgcttcggtgtcgaaatgagaagaagaggcacagggctgtgaggcttatcttcaccatc
atgattgtttattttctcttctgggctccctacaacattgtccttctcctgaacaccttc
caggaattctttggcctgaataattgcagtagctctaacaggttggaccaagctatgcag
gtgacagagactcttgggatgacgcactgctgcatcaaccccatcatctatgcctttgtc
ggggagaagttcagaaactacctcttagtcttcttccaaaagcacattgccaaacgcttc
tgcaaatgctgttctattttccagcaagaggctcccgagcgagcaagctcagtttacacc
cgatccactggggagcaggaaatatctgtgggcttgtga

DBGET integrated database retrieval system