KEGG   Homo sapiens (human): 145957
Entry
145957            CDS       T01001                                 

Gene name
NRG4, HRG4
Definition
(RefSeq) neuregulin 4
  KO
K05458  neuregulin 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04012  ErbB signaling pathway
hsa05014  Amyotrophic lateral sclerosis
Network
nt06415  PI3K signaling
nt06464  Amyotrophic lateral sclerosis
  Element
N01163  NRG-ERBB4-PI3K signaling pathway
N01164  Mutation-inactivated ERBB4 to NRG-ERBB4-PI3K signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    145957 (NRG4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    145957 (NRG4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    145957 (NRG4)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   145957 (NRG4)
SSDB
Motif
Pfam: EGF EGF_2 Laminin_EGF
Other DBs
NCBI-GeneID: 145957
NCBI-ProteinID: NP_612640
OMIM: 610894
HGNC: 29862
Ensembl: ENSG00000169752
Vega: OTTHUMG00000142917
Pharos: Q8WWG1(Tbio)
UniProt: Q8WWG1
LinkDB
Position
15q24.2
AA seq 115 aa
MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSN
LFEAFVALAVLVTLIIGAFYFLCRKGHFQRASSVQYDINLVETSSTSAHHSHEQH
NT seq 348 nt   +upstreamnt  +downstreamnt
atgccaacagatcacgaagagccctgtggtcccagtcacaagtcgttttgcctgaatggg
gggctttgttatgtgatacctactattcccagcccattttgtaggtgcgttgaaaactat
acaggagctcgttgtgaagaggtttttctcccaggctccagcatccaaactaaaagtaac
ctgtttgaagcttttgtggcattggcggtcctagtaacacttatcattggagccttctac
ttcctttgcaggaaaggccactttcagagagccagttcagtccagtatgatatcaacctg
gtagagacgagcagtaccagtgcccaccacagtcatgaacaacactga

DBGET integrated database retrieval system