KEGG   Homo sapiens (human): 1909Help
Entry
1909              CDS       T01001                                 

Gene name
EDNRA, ET-A, ETA, ETA-R, ETAR, ETRA, MFDA, hET-AR
Definition
(RefSeq) endothelin receptor type A
  KO
K04197  endothelin receptor type A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04270  Vascular smooth muscle contraction
hsa04924  Renin secretion
hsa05200  Pathways in cancer
Disease
H02126  Mandibulofacial dysostosis with alopecia
Drug target
Ambrisentan: D07077
Aprocitentan: D11441
Atrasentan hydrochloride: D03009
Bosentan (DG00266): D01227 D07538
Clazosentan (DG03076): D07682 D11664
Edonentan: D03953
Fandosentan potassium: D04128
Macitentan: D10135
Sitaxentan (DG00267): D07171 D08517
Zibotentan: D07741
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    1909 (EDNRA)
   04024 cAMP signaling pathway
    1909 (EDNRA)
   04022 cGMP-PKG signaling pathway
    1909 (EDNRA)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1909 (EDNRA)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    1909 (EDNRA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    1909 (EDNRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    1909 (EDNRA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1909 (EDNRA)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Endothelin
    1909 (EDNRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 1909
NCBI-ProteinID: NP_001948
OMIM: 131243
HGNC: 3179
Ensembl: ENSG00000151617
Vega: OTTHUMG00000161354
Pharos: P25101(Tclin)
UniProt: P25101
LinkDB All DBs
Position
4q31.22-q31.23
AA seq 427 aa AA seqDB search
METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLP
SNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIA
SLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALS
VDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCM
LNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQ
RREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATM
NSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRS
SHKDSMN
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccctttgcctcagggcatccttttggctggcactggttggatgtgtaatcagt
gataatcctgagagatacagcacaaatctaagcaatcatgtggatgatttcaccactttt
cgtggcacagagctcagcttcctggttaccactcatcaacccactaatttggtcctaccc
agcaatggctcaatgcacaactattgcccacagcagactaaaattacttcagctttcaaa
tacattaacactgtgatatcttgtactattttcatcgtgggaatggtggggaatgcaact
ctgctcaggatcatttaccagaacaaatgtatgaggaatggccccaacgcgctgatagcc
agtcttgcccttggagaccttatctatgtggtcattgatctccctatcaatgtatttaag
ctgctggctgggcgctggccttttgatcacaatgactttggcgtatttctttgcaagctg
ttcccctttttgcagaagtcctcggtggggatcaccgtcctcaacctctgcgctcttagt
gttgacaggtacagagcagttgcctcctggagtcgtgttcagggaattgggattcctttg
gtaactgccattgaaattgtctccatctggatcctgtcctttatcctggccattcctgaa
gcgattggcttcgtcatggtaccctttgaatataggggtgaacagcataaaacctgtatg
ctcaatgccacatcaaaattcatggagttctaccaagatgtaaaggactggtggctcttc
gggttctatttctgtatgcccttggtgtgcactgcgatcttctacaccctcatgacttgt
gagatgttgaacagaaggaatggcagcttgagaattgccctcagtgaacatcttaagcag
cgtcgagaagtggcaaaaacagttttctgcttggttgtaatttttgctctttgctggttc
cctcttcatttaagccgtatattgaagaaaactgtgtataacgagatggacaagaaccga
tgtgaattacttagtttcttactgctcatggattacatcggtattaacttggcaaccatg
aattcatgtataaaccccatagctctgtattttgtgagcaagaaatttaaaaattgtttc
cagtcatgcctctgctgctgctgttaccagtccaaaagtctgatgacctcggtccccatg
aacggaacaagcatccagtggaagaaccacgatcaaaacaaccacaacacagaccggagc
agccataaggacagcatgaactga

DBGET integrated database retrieval system