KEGG   Homo sapiens (human): 221357
Entry
221357            CDS       T01001                                 

Gene name
GSTA5
Definition
(RefSeq) glutathione S-transferase alpha 5
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
nt06463  Parkinson disease
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    221357 (GSTA5)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    221357 (GSTA5)
   00982 Drug metabolism - cytochrome P450
    221357 (GSTA5)
   00983 Drug metabolism - other enzymes
    221357 (GSTA5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    221357 (GSTA5)
   05204 Chemical carcinogenesis
    221357 (GSTA5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    221357 (GSTA5)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    221357 (GSTA5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    221357 (GSTA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    221357 (GSTA5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     221357 (GSTA5)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   221357 (GSTA5)
SSDB
Motif
Pfam: GST_C_3 GST_C GST_N GST_N_3 GST_C_2
Other DBs
NCBI-GeneID: 221357
NCBI-ProteinID: NP_714543
OMIM: 607605
HGNC: 19662
Ensembl: ENSG00000182793
Vega: OTTHUMG00000014857
Pharos: Q7RTV2(Tdark)
UniProt: Q7RTV2
LinkDB
Position
6p12.2
AA seq 222 aa
MAEKPKLHYSNARGSMESIRWLLAAAGVELEEKFLESAEDLDKLRNDGSLLFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDMKERALIDMYTEGIVDLTEMILLLLICQPEERDAK
TALVKEKIKNRYFPAFEKVLKSHRQDYLVGNKLSWADIHLVELFYYVEELDSSLISSFPL
LKALKTRISNLPTVKKFLQPGSQRKPPMDEKSLEEARKIFRF
NT seq 669 nt   +upstreamnt  +downstreamnt
atggcagagaagcccaagctccactactccaatgcacggggcagtatggagtccattcgg
tggctcctggctgcagctggagtagagttggaagagaaatttctagaatctgcagaagat
ttggacaagttaagaaatgatgggagtttgctgttccagcaagtaccaatggttgagatt
gacgggatgaagctggtgcagaccagagccattcttaactacattgccagcaaatacaac
ctttatgggaaagacatgaaggagagagccctgattgatatgtacacagaaggtatagta
gatttgactgaaatgatccttcttctgctcatatgtcaaccagaggaaagagatgccaag
actgccttggtcaaagagaaaataaaaaatcgctacttccctgcctttgaaaaagtctta
aagagccacagacaagactaccttgttggcaacaagctgagctgggctgacattcacctg
gtggaacttttctactacgtggaagagcttgactcgagtcttatctccagcttccctctg
ctgaaggccctgaaaaccagaatcagcaacctgcccacggtgaagaagtttctgcagcct
ggcagccagagaaagcctcccatggatgagaaatctttagaagaagcaaggaagattttc
aggttttaa

DBGET integrated database retrieval system