KEGG   Homo sapiens (human): 2898
Entry
2898              CDS       T01001                                 
Symbol
GRIK2, EAA4, GLR6, GLUK6, GLUR6, GluK2, MRT6, NEDLAS
Name
(RefSeq) glutamate ionotropic receptor kainate type subunit 2
  KO
K05202  glutamate receptor, ionotropic kainate 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04724  Glutamatergic synapse
Disease
H00768  Autosomal recessive intellectual developmental disorder
Drug target
Dasolampanel: D10107
Dasolampanel etibutil: D10108
Dasolampanel etibutil tosylate: D10109
Riluzole: D00775<JP/US>
Tezampanel: D06656
Topiramate: D00537<JP/US>
Troriluzole (DG03011): D11414 D11415
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2898 (GRIK2)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    2898 (GRIK2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2898 (GRIK2)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   2898 (GRIK2)
SSDB
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 Peripla_BP_6
Other DBs
NCBI-GeneID: 2898
NCBI-ProteinID: NP_068775
OMIM: 138244
HGNC: 4580
Ensembl: ENSG00000164418
Pharos: Q13002(Tclin)
UniProt: Q13002 Q8IY40 A8K0H7
Structure
LinkDB
Position
6:101393708..102070083
AA seq 908 aa
MKIIFPILSNPVFRRTVKLLLCLLWIGYSQGTTHVLRFGGIFEYVESGPMGAEELAFRFA
VNTINRNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQS
ICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDST
GLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILK
QALAMGMMTEYYHYIFTTLDLFALDVEPYRYSGVNMTGFRILNTENTQVSSIIEKWSMER
LQAPPKPDSGLLDGFMTTDAALMYDAVHVVSVAVQQFPQMTVSSLQCNRHKPWRFGTRFM
SLIKEAHWEGLTGRITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTESQKGK
PANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEI
RLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISI
LYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSD
VVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLT
VERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKS
NEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITI
AILQLQEEGKLHMMKEKWWRGNGCPEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVG
EFLYKSKKNAQLEKRSFCSAMVEELRMSLKCQRRLKHKPQAPVIVKTEEVINMHTFNDRR
LPGKETMA
NT seq 2727 nt   +upstreamnt  +downstreamnt
atgaagattattttcccgattctaagtaatccagtcttcaggcgcaccgttaaactcctg
ctctgtttactgtggattggatattctcaaggaaccacacatgtattaagatttggtggt
atttttgaatatgtggaatctggcccaatgggagctgaggaacttgcattcagatttgct
gtgaacacaattaacagaaacagaacattgctacccaatactacccttacctatgatacc
cagaagataaacctttatgatagttttgaagcatccaagaaagcctgtgatcagctgtct
cttggggtggctgccatcttcgggccttcacacagctcatcagcaaacgcagtgcagtcc
atctgcaatgctctgggagttccccacatacagacccgctggaagcaccaggtgtcagac
aacaaagattccttctatgtcagtctctacccagacttctcttcactcagccgtgccatt
ttagacctggtgcagtttttcaagtggaaaaccgtcacggttgtgtatgatgacagcact
ggtctcattcgtttgcaagagctcatcaaagctccatcaaggtataatcttcgactcaaa
attcgtcagttacctgctgatacaaaggatgcaaaacccttactaaaagaaatgaaaaga
ggcaaggagtttcatgtaatctttgattgtagccatgaaatggcagcaggcattttaaaa
caggcattagctatgggaatgatgacagaatactatcattatatctttaccactctggac
ctctttgctcttgatgttgagccctaccgatacagtggtgttaacatgacagggttcaga
atattaaatacagaaaatacccaagtctcctccatcattgaaaagtggtcgatggaacga
ttgcaggcacctccgaaacccgattcaggtttgctggatggatttatgacgactgatgct
gctctaatgtatgatgctgtgcatgtggtgtctgtggccgttcaacagtttccccagatg
acagtcagttccttgcagtgtaatcgacataaaccctggcgcttcgggacccgctttatg
agtctaattaaagaggcacattgggaaggcctcacaggcagaataactttcaacaaaacc
aatggcttgagaacagattttgatttggatgtgatcagtctgaaggaagaaggtctagaa
aagattggaacgtgggatccagccagtggcctgaatatgacagaaagtcaaaagggaaag
ccagcgaacatcacagattccttatccaatcgttctttgattgttaccaccattttggaa
gagccttatgtcctttttaagaagtctgacaaacctctctatggtaatgatcgatttgaa
ggctattgcattgatctcctcagagagttatctacaatccttggctttacatatgaaatt
agacttgtggaagatgggaaatatggagcccaggatgatgccaatggacaatggaatgga
atggttcgtgaactaattgatcataaagctgaccttgcagttgctccactggctattacc
tatgttcgagagaaggtcatcgacttttccaagccctttatgacacttggaataagtatt
ttgtaccgcaagcccaatggtacaaacccaggcgtcttctccttcctgaatcctctctcc
cctgatatctggatgtatattctgctggcttacttgggtgtcagttgtgtgctctttgtc
atagccaggtttagtccttatgagtggtataatccacacccttgcaaccctgactcagac
gtggtggaaaacaattttaccttgctaaatagtttctggtttggagttggagctctcatg
cagcaaggttctgagctcatgcccaaagcactgtccaccaggatagtgggaggcatttgg
tggtttttcacacttatcatcatttcttcgtatactgctaacttagccgcctttctgaca
gtggaacgcatggaatcccctattgactctgctgatgatttagctaaacaaaccaagata
gaatatggagcagtagaggatggtgcaaccatgacttttttcaagaaatcaaaaatctcc
acgtatgacaaaatgtgggcctttatgagtagcagaaggcagtcagtgctggtcaaaagt
aatgaagaaggaatccagcgagtcctcacctctgattatgctttcctaatggagtcaaca
accatcgagtttgttacccagcggaactgtaacctgacacagattggcggccttatagac
tctaaaggttatggcgttggcactcccatgggttctccatatcgagacaaaattaccata
gcaattcttcagctgcaagaggaaggcaaactgcatatgatgaaggagaaatggtggagg
ggcaatggttgcccagaagaggagagcaaagaggccagtgccctgggggttcagaatatt
ggtggcatcttcattgttctggcagccggcttggtgctttcagtttttgtggcagtggga
gaatttttatacaaatccaaaaaaaacgctcaattggaaaagaggtccttctgtagtgcc
atggtagaagaattgaggatgtccctgaagtgccagcgtcggttaaaacataagccacag
gccccagttattgtgaaaacagaagaagttatcaacatgcacacatttaacgacagaagg
ttgccaggtaaagaaaccatggcataa

DBGET integrated database retrieval system