KEGG   Homo sapiens (human): 3107Help
Entry
3107              CDS       T01001                                 

Gene name
HLA-C, D6S204, HLA-JY3, HLAC, HLC-C, MHC, PSORS1
Definition
(RefSeq) major histocompatibility complex, class I, C
  KO
K06751  major histocompatibility complex, class I
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa04218  Cellular senescence
hsa04514  Cell adhesion molecules (CAMs)
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa04940  Type I diabetes mellitus
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  HTLV-I infection
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
hsa05320  Autoimmune thyroid disease
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
N00184  KSHV MIR1/2 to MHC1-endocytosis
N00210  KSHV MIR1/2 to host-cell-protein inhibition
Disease
H00344  Leprosy
Drug target
Glatiramer acetate: D04318
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3107 (HLA-C)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    3107 (HLA-C)
   04145 Phagosome
    3107 (HLA-C)
  Cell growth and death
   04218 Cellular senescence
    3107 (HLA-C)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    3107 (HLA-C)
   04612 Antigen processing and presentation
    3107 (HLA-C)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    3107 (HLA-C)
  Immune diseases
   05320 Autoimmune thyroid disease
    3107 (HLA-C)
   05330 Allograft rejection
    3107 (HLA-C)
   05332 Graft-versus-host disease
    3107 (HLA-C)
  Cardiovascular diseases
   05416 Viral myocarditis
    3107 (HLA-C)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    3107 (HLA-C)
  Infectious diseases
   05166 HTLV-I infection
    3107 (HLA-C)
   05168 Herpes simplex infection
    3107 (HLA-C)
   05163 Human cytomegalovirus infection
    3107 (HLA-C)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    3107 (HLA-C)
   05169 Epstein-Barr virus infection
    3107 (HLA-C)
   05165 Human papillomavirus infection
    3107 (HLA-C)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3107 (HLA-C)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  3107 (HLA-C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I C1-set MHC_I_C C2-set_2 MHC_I_3 ig P12 DUF4448
Motif
Other DBs
NCBI-GeneID: 3107
NCBI-ProteinID: NP_002108
OMIM: 142840
HGNC: 4933
Ensembl: ENSG00000204525
Vega: OTTHUMG00000031154
Pharos: P10321(Tbio)
UniProt: P10321 Q6R739 Q95HC2
LinkDB All DBs
Structure
PDB: 

Position
6p21.33
AA seq 366 aa AA seqDB search
MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRF
DSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQ
RMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQL
RAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQEPLTLSWEP
SSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGGKGGSCSQAACSNSAQGSDES
LITCKA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtcatggcgccccgagccctcctcctgctgctctcgggaggcctggccctgacc
gagacctgggcctgctcccactccatgaggtatttcgacaccgccgtgtcccggcccggc
cgcggagagccccgcttcatctcagtgggctacgtggacgacacgcagttcgtgcggttc
gacagcgacgccgcgagtccgagaggggagccgcgggcgccgtgggtggagcaggagggg
ccggagtattgggaccgggagacacagaagtacaagcgccaggcacaggctgaccgagtg
agcctgcggaacctgcgcggctactacaaccagagcgaggacgggtctcacaccctccag
aggatgtctggctgcgacctggggcccgacgggcgcctcctccgcgggtatgaccagtcc
gcctacgacggcaaggattacatcgccctgaacgaggacctgcgctcctggaccgccgcg
gacaccgcggctcagatcacccagcgcaagttggaggcggcccgtgcggcggagcagctg
agagcctacctggagggcacgtgcgtggagtggctccgcagatacctggagaacgggaag
gagacgctgcagcgcgcagaacccccaaagacacacgtgacccaccaccccctctctgac
catgaggccaccctgaggtgctgggccctgggcttctaccctgcggagatcacactgacc
tggcagcgggatggggaggaccagacccaggacaccgagcttgtggagaccaggccagca
ggagatggaaccttccagaagtgggcagctgtggtggtgccttctggacaagagcagaga
tacacgtgccatatgcagcacgaggggctgcaagagcccctcaccctgagctgggagcca
tcttcccagcccaccatccccatcatgggcatcgttgctggcctggctgtcctggttgtc
ctagctgtccttggagctgtggtcaccgctatgatgtgtaggaggaagagctcaggtgga
aaaggagggagctgctctcaggctgcgtgcagcaacagtgcccagggctctgatgagtct
ctcatcacttgtaaagcctga

DBGET integrated database retrieval system