KEGG   Homo sapiens (human): 5151
Entry
5151              CDS       T01001                                 

Gene name
PDE8A, HsT19550
Definition
(RefSeq) phosphodiesterase 8A
  KO
K18437  high affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8 [EC:3.1.4.53]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04927  Cortisol synthesis and secretion
hsa04934  Cushing syndrome
hsa05032  Morphine addiction
Drug target
Aminophylline (DG01062): D00227 D05429<JP> D11630<US>
Bemoradan: D03075
Bucladesine (DG00230): D01238<JP> D07546
Choline theophyllinate: D02017
Diprophylline: D00691<JP>
Enprofylline: D04006
Flavoxate (DG00477): D00718<JP/US> D07961
Moxaverine (DG00045): D07089 D08238
Oxagrelate: D05278
Papaverine (DG00043): D02218<JP> D07425 D07439
Prinoxodan: D05612
Proxyphylline: D01771<JP>
Theophylline (DG01061): D00371<JP/US> D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Trapidil: D01220<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5151 (PDE8A)
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    5151 (PDE8A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    5151 (PDE8A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    5151 (PDE8A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     5151 (PDE8A)
SSDB
Motif
Pfam: PDEase_I PAS PAS_9 PAS_4 PAS_3 PDE8 PAS_8 HTH_23
Other DBs
NCBI-GeneID: 5151
NCBI-ProteinID: NP_002596
OMIM: 602972
HGNC: 8793
Ensembl: ENSG00000073417
Vega: OTTHUMG00000148670
Pharos: O60658(Tclin)
UniProt: O60658
LinkDB
Structure
PDB: 
3ECM 3ECN

Position
15q25.3
AA seq 829 aa
MGCAPSIHISERLVAEDAPSPAAPPLSSGGPRLPQGQKTAALPRTRGAGLLESELRDGSG
KKVAVADVQFGPMRFHQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACF
LDKHHDIIIIDHRNPRQLDAEALCRSIRSSKLSENTVIVGVVRRVDREELSVMPFISAGF
TRRYVENPNIMACYNELLQLEFGEVRSQLKLRACNSVFTALENSEDAIEITSEDRFIQYA
NPAFETTMGYQSGELIGKELGEVPINEKKADLLDTINSCIRIGKEWQGIYYAKKKNGDNI
QQNVKIIPVIGQGGKIRHYVSIIRVCNGNNKAEKISECVQSDTHTDNQTGKHKDRRKGSL
DVKAVASRATEVSSQRRHSSMARIHSMTIEAPITKVINIINAAQESSPMPVTEALDRVLE
ILRTTELYSPQFGAKDDDPHANDLVGGLMSDGLRRLSGNEYVLSTKNTQMVSSNIITPIS
LDDVPPRIARAMENEEYWDFDIFELEAATHNRPLIYLGLKMFARFGICEFLHCSESTLRS
WLQIIEANYHSSNPYHNSTHSADVLHATAYFLSKERIKETLDPIDEVAALIAATIHDVDH
PGRTNSFLCNAGSELAILYNDTAVLESHHAALAFQLTTGDDKCNIFKNMERNDYRTLRQG
IIDMVLATEMTKHFEHVNKFVNSINKPLATLEENGETDKNQEVINTMLRTPENRTLIKRM
LIKCADVSNPCRPLQYCIEWAARISEEYFSQTDEEKQQGLPVVMPVFDRNTCSIPKSQIS
FIDYFITDMFDAWDAFVDLPDLMQHLDNNFKYWKGLDEMKLRNLRPPPE
NT seq 2490 nt   +upstreamnt  +downstreamnt
atgggctgtgccccgagcatccacatttccgagcgcctggtggccgaggacgcgcctagc
cccgcggcaccgccgctgtcgtccggcgggccgcgcctcccgcagggccagaagacggcc
gccttgccccggacccgcggcgccggcctcttggagtcggagcttcgcgacggcagcggc
aagaaggtagcagtagctgatgtgcagtttggccccatgagatttcatcaagatcaactt
caggtacttttagtgtttaccaaagaagataaccaatgtaatggattctgcagggcatgt
gaaaaagcagggtttaagtgtacagttaccaaggaggctcaggctgtccttgcctgtttc
ctggacaaacatcatgacattatcatcatagaccacagaaatcctcgacagctggatgca
gaggcactgtgcaggtctatcagatcatcaaaactctcagaaaacacagttattgttggt
gtagtacgcagggtggatagagaagagttgtccgtaatgcctttcatttctgctggattt
acaaggaggtatgtagaaaaccccaacatcatggcctgctacaatgaactgctccagctg
gagtttggagaggtgcgatcacaactgaaactcagggcttgtaactcagtattcactgca
ttagaaaacagtgaagatgcaattgaaattacaagcgaagaccgttttatacagtatgca
aatcctgcatttgaaacaacaatgggctatcagtcaggtgaattaatagggaaggagtta
ggagaagtgcctataaatgaaaaaaaggctgacttgctcgatactataaattcatgcatc
aggataggcaaggagtggcaaggaatttactatgccaaaaagaaaaacggagataatata
caacaaaatgtgaagataatacctgtcattggacagggaggaaaaattagacactatgtg
tccattatcagagtgtgcaatggcaacaataaggctgagaaaatatccgaatgtgttcag
tctgacactcatacagataatcagacaggcaaacataaagacaggagaaaaggctcacta
gacgtcaaagctgttgcctcccgtgcaactgaagtttccagccagagacgacactcttcc
atggcccggatacattccatgacaattgaggcgcccatcaccaaggtaatcaatattatc
aatgctgcccaggaaagtagtcccatgcctgtgacagaagccctagaccgtgtgctggaa
attctaagaaccactgagttatattcaccacagtttggtgctaaagatgatgatccccat
gccaatgaccttgttgggggcttaatgtctgatggtttgcgaagactatcagggaatgaa
tatgttctttcaacaaaaaacactcaaatggtttcaagcaatataatcactcccatctcc
cttgatgatgtcccaccacggatagctcgggccatggaaaatgaggaatactgggacttt
gatatttttgaactggaggctgccacccacaataggcctttgatttatcttggtctcaaa
atgtttgctcgctttggaatctgtgaattcttacactgctccgagtcaacgctaagatca
tggttacaaattatcgaagccaattatcattcctccaatccctaccacaattctacacat
tctgctgatgtgcttcatgccactgcctattttctctccaaggagaggataaaggaaact
ttagatccaattgatgaggtcgctgcactcatcgcagccaccattcatgatgtggatcac
cctgggagaaccaactccttcctgtgtaatgctggaagtgagctggccattttgtacaat
gacactgctgtgctggagagccaccatgcggccttggccttccagctgaccactggagat
gataaatgcaatatatttaaaaacatggagaggaatgattatcggacactgcgccagggg
attatcgacatggtcttagccacagaaatgacaaagcactttgagcatgtcaacaaattt
gtcaacagcatcaacaaacccttggcaacactagaagaaaatggggaaactgataaaaac
caggaagtgataaacactatgcttaggactccagagaaccggaccctaatcaaacgaatg
ctgattaaatgtgctgatgtgtccaatccctgccgacccctgcagtactgcatcgagtgg
gctgcacgcatttcggaagaatatttttctcagactgatgaagagaagcagcagggctta
cctgtggtgatgccagtgtttgacagaaatacctgcagcatccccaaatcccaaatctct
ttcattgattacttcatcacagacatgtttgatgcttgggatgcctttgtagacctgcct
gatttaatgcagcatcttgacaacaactttaaatactggaaaggactggacgaaatgaag
ctgcggaacctccgaccacctcctgaatag

KEGG   Homo sapiens (human): 8622
Entry
8622              CDS       T01001                                 

Gene name
PDE8B, ADSD, PPNAD3
Definition
(RefSeq) phosphodiesterase 8B
  KO
K18437  high affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8 [EC:3.1.4.53]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04927  Cortisol synthesis and secretion
hsa04934  Cushing syndrome
hsa05032  Morphine addiction
Network
nt06310  CRH-ACTH-cortisol signaling
nt06360  Cushing syndrome
  Element
N00323  Mutation-inactivated PDE11A/PDE8B to ACTH-cortisol signaling pathway
Disease
H00260  Pigmented micronodular adrenocortical disease
H01431  Cushing syndrome
H01570  Autosomal dominant striatal degeneration
Drug target
Aminophylline (DG01062): D00227 D05429<JP> D11630<US>
Bemoradan: D03075
Bucladesine (DG00230): D01238<JP> D07546
Choline theophyllinate: D02017
Diprophylline: D00691<JP>
Enprofylline: D04006
Flavoxate (DG00477): D00718<JP/US> D07961
Moxaverine (DG00045): D07089 D08238
Oxagrelate: D05278
Papaverine (DG00043): D02218<JP> D07425 D07439
Prinoxodan: D05612
Proxyphylline: D01771<JP>
Theophylline (DG01061): D00371<JP/US> D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Trapidil: D01220<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    8622 (PDE8B)
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    8622 (PDE8B)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    8622 (PDE8B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    8622 (PDE8B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     8622 (PDE8B)
SSDB
Motif
Pfam: PDEase_I PDE8 PAS_9 PAS PAS_3 PAS_4 PAS_8
Other DBs
NCBI-GeneID: 8622
NCBI-ProteinID: NP_003710
OMIM: 603390
HGNC: 8794
Ensembl: ENSG00000113231 ENSG00000284762
Vega: OTTHUMG00000102170
Pharos: O95263(Tclin)
UniProt: O95263 B3KN77
LinkDB
Position
5q13.3
AA seq 885 aa
MGCAPSIHVSQSGVIYCRDSDESSSPRQTTSVSQGPAAPLPGLFVQTDAADAIPPSRASG
PPSVARVRRARTELGSGSSAGSAAPAATTSRGRRRHCCSSAEAETQTCYTSVKQVSSAEV
RIGPMRLTQDPIQVLLIFAKEDSQSDGFWWACDRAGYRCNIARTPESALECFLDKHHEII
VIDHRQTQNFDAEAVCRSIRATNPSEHTVILAVVSRVSDDHEEASVLPLLHAGFNRRFME
NSSIIACYNELIQIEHGEVRSQFKLRACNSVFTALDHCHEAIEITSDDHVIQYVNPAFER
MMGYHKGELLGKELADLPKSDKNRADLLDTINTCIKKGKEWQGVYYARRKSGDSIQQHVK
ITPVIGQGGKIRHFVSLKKLCCTTDNNKQIHKIHRDSGDNSQTEPHSFRYKNRRKESIDV
KSISSRGSDAPSLQNRRYPSMARIHSMTIEAPITKVINIINAAQENSPVTVAEALDRVLE
ILRTTELYSPQLGTKDEDPHTSDLVGGLMTDGLRRLSGNEYVFTKNVHQSHSHLAMPITI
NDVPPCISQLLDNEESWDFNIFELEAITHKRPLVYLGLKVFSRFGVCEFLNCSETTLRAW
FQVIEANYHSSNAYHNSTHAADVLHATAFFLGKERVKGSLDQLDEVAALIAATVHDVDHP
GRTNSFLCNAGSELAVLYNDTAVLESHHTALAFQLTVKDTKCNIFKNIDRNHYRTLRQAI
IDMVLATEMTKHFEHVNKFVNSINKPMAAEIEGSDCECNPAGKNFPENQILIKRMMIKCA
DVANPCRPLDLCIEWAGRISEEYFAQTDEEKRQGLPVVMPVFDRNTCSIPKSQISFIDYF
ITDMFDAWDAFAHLPALMQHLADNYKHWKTLDDLKCKSLRLPSDS
NT seq 2658 nt   +upstreamnt  +downstreamnt
atgggctgcgcccccagcatccatgtctcgcagagcggcgtgatctactgccgggactcg
gacgagtccagctcgccccgccagaccaccagcgtgtcgcagggcccggcggcacccctg
cccggcctcttcgtccagaccgacgccgccgacgccatccccccgagccgcgcgtcggga
ccccccagcgtagcccgcgtccgcagggcccgcaccgagctgggcagcggtagcagcgcg
ggttccgcagcccccgccgcgaccaccagcaggggccggaggcgccactgctgcagcagc
gccgaggccgagactcagacctgctacaccagcgtgaagcaggtgtcttctgcggaggtg
cgcatcgggcccatgagactgacgcaggaccctattcaggttttgctgatctttgcaaag
gaagatagtcagagcgatggcttctggtgggcctgcgacagagctggttatagatgcaat
attgctcggactccagagtcagcccttgaatgctttcttgataagcatcatgaaattatt
gtaattgatcatagacaaactcagaacttcgatgcagaagcagtgtgcaggtcgatccgg
gccacaaatccctccgagcacacggtgatcctcgcagtggtttcgcgagtatcggatgac
catgaagaggcgtcagtccttcctcttctccacgcaggcttcaacaggagatttatggag
aatagcagcataattgcttgctataatgaactgattcaaatagaacatggggaagttcgc
tcccagttcaaattacgggcctgtaattcagtgtttacagcattagatcactgtcatgaa
gccatagaaataacaagcgatgaccacgtgattcagtatgtcaacccagccttcgaaagg
atgatgggctaccacaaaggtgagctcctgggaaaagaactcgctgatctgcccaaaagc
gataagaaccgggcagaccttctcgacaccatcaatacatgcatcaagaagggaaaggag
tggcagggggtttactatgccagacggaaatccggggacagcatccaacagcacgtgaag
atcaccccagtgattggccaaggagggaaaattaggcattttgtctcgctcaagaaactg
tgttgtaccactgacaataataagcagattcacaagattcatcgtgattcaggagacaat
tctcagacagagcctcattcattcagatataagaacaggaggaaagagtccattgacgtg
aaatcgatatcatctcgaggcagtgatgcaccaagcctgcagaatcgtcgctatccgtcc
atggcgaggatccactccatgaccatcgaggctcccatcacaaaggttataaatataatc
aatgcagcccaagaaaacagcccagtcacagtagcggaagccttggacagagttctagag
attttacggaccacagaactgtactcccctcagctgggtaccaaagatgaagatccccac
accagtgatcttgttggaggcctgatgactgacggcttgagaagactgtcaggaaacgag
tatgtgtttactaagaatgtgcaccagagtcacagtcaccttgcaatgccaataaccatc
aatgatgttcccccttgtatctctcaattacttgataatgaggagagttgggacttcaac
atctttgaattggaagccattacgcataaaaggccattggtttatctgggcttaaaggtc
ttctctcggtttggagtatgtgaatttttaaactgttctgaaaccactcttcgggcctgg
ttccaagtgatcgaagccaactaccactcttccaatgcctaccacaactccacccatgct
gccgacgtcctgcacgccaccgctttctttcttggaaaggaaagagtaaagggaagcctc
gatcagttggatgaggtggcagccctcattgctgccacagtccatgacgtggatcacccg
ggaaggaccaactctttcctctgcaatgcaggcagtgagcttgctgtgctctacaatgac
actgctgttctggagagtcaccacaccgccctggccttccagctcacggtcaaggacacc
aaatgcaacattttcaagaatattgacaggaaccattatcgaacgctgcgccaggctatt
attgacatggttttggcaacagagatgacaaaacactttgaacatgtgaataagtttgtg
aacagcatcaacaagccaatggcagctgagattgaaggcagcgactgtgaatgcaaccct
gctgggaagaacttccctgaaaaccaaatcctgatcaaacgcatgatgattaagtgtgct
gacgtggccaacccatgccgccccttggacctgtgcattgaatgggctgggaggatctct
gaggagtattttgcacagactgatgaagagaagagacagggactacctgtggtgatgcca
gtgtttgaccggaatacctgtagcatccccaagtctcagatctctttcattgactacttc
ataacagacatgtttgatgcttgggatgcctttgcacatctgccagccctgatgcaacat
ttggctgacaactacaaacactggaagacactagatgacctaaagtgcaaaagtttgagg
cttccatctgacagctaa

DBGET integrated database retrieval system