KEGG   Homo sapiens (human): 5693
Entry
5693              CDS       T01001                                 

Gene name
PSMB5, LMPX, MB1, X
Definition
(RefSeq) proteasome 20S subunit beta 5
  KO
K02737  20S proteasome subunit beta 5 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
Drug target
Bortezomib: D03150
Carfilzomib: D08880
Delanzomib: D10110
Ixazomib (DG01269): D10130 D10131
Marizomib: D09640
Oprozomib: D10318
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5693 (PSMB5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5693 (PSMB5)
   05012 Parkinson disease
    5693 (PSMB5)
   05016 Huntington disease
    5693 (PSMB5)
   05017 Spinocerebellar ataxia
    5693 (PSMB5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5693 (PSMB5)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5693 (PSMB5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5693 (PSMB5)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   5693 (PSMB5)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    5693 (PSMB5)
SSDB
Motif
Pfam: Proteasome DUF3991
Other DBs
NCBI-GeneID: 5693
NCBI-ProteinID: NP_002788
OMIM: 600306
HGNC: 9542
Ensembl: ENSG00000100804
Vega: OTTHUMG00000028713
Pharos: P28074(Tclin)
UniProt: P28074
LinkDB
Structure
PDB: 

Position
14q11.2
AA seq 263 aa
MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGT
TTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLAR
QCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRI
SGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVRE
DGWIRVSSDNVADLHEKYSGSTP
NT seq 792 nt   +upstreamnt  +downstreamnt
atggcgcttgccagcgtgttggagagaccgctaccggtgaaccagcgcgggtttttcgga
cttgggggtcgtgcagatctgctggatctaggtccagggagtctcagtgatggtctgagc
ctggccgcgccaggctggggtgtcccagaagagccaggaatcgaaatgcttcatggaaca
accaccctggccttcaagttccgccatggagtcatagttgcagctgactccagggctaca
gcgggtgcttacattgcctcccagacggtgaagaaggtgatagagatcaacccatacctg
ctaggcaccatggctgggggcgcagcggattgcagcttctgggaacggctgttggctcgg
caatgtcgaatctatgagcttcgaaataaggaacgcatctctgtagcagctgcctccaaa
ctgcttgccaacatggtgtatcagtacaaaggcatggggctgtccatgggcaccatgatc
tgtggctgggataagagaggccctggcctctactacgtggacagtgaagggaaccggatt
tcaggggccaccttctctgtaggttctggctctgtgtatgcatatggggtcatggatcgg
ggctattcctatgacctggaagtggagcaggcctatgatctggcccgtcgagccatctac
caagccacctacagagatgcctactcaggaggtgcagtcaacctctaccacgtgcgggag
gatggctggatccgagtctccagtgacaatgtggctgatctacatgagaagtatagtggc
tctaccccctga

DBGET integrated database retrieval system