KEGG   Homo sapiens (human): 7357Help
Entry
7357              CDS       T01001                                 

Gene name
UGCG, GCS, GLCT1
Definition
(RefSeq) UDP-glucose ceramide glucosyltransferase
  KO
K00720  ceramide glucosyltransferase [EC:2.4.1.80]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
Module
hsa_M00066  Lactosylceramide biosynthesis
Network
nt06014  Sphingolipid degradation
  Element
N00679  Glucosylceramide synthesis in GBA deficiency
N10018  UGCG inhibitor for deficient GBA
Drug target
Eliglustat (DG00148): D09893 D09894
Lucerastat: D11439
Miglustat: D05032
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    7357 (UGCG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    7357 (UGCG)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    7357 (UGCG)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.80  ceramide glucosyltransferase
     7357 (UGCG)
Glycosyltransferases [BR:hsa01003]
 Glycolipid biosynthesis
  Glycosphingolipid
   7357 (UGCG)
Transporters [BR:hsa02000]
 Other Transporters
  Others
   7357 (UGCG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_21 Glyco_tranf_2_3 Glyco_trans_2_3 Glycos_transf_2 Chitin_synth_2
Motif
Other DBs
NCBI-GeneID: 7357
NCBI-ProteinID: NP_003349
OMIM: 602874
HGNC: 12524
Ensembl: ENSG00000148154
Vega: OTTHUMG00000020498
Pharos: Q16739(Tclin)
UniProt: Q16739 A0A024R157
LinkDB All DBs
Position
9q31.3
AA seq 394 aa AA seqDB search
MALLDLALEGMAVFGFVLFLVLWLMHFMAIIYTRLHLNKKATDKQPYSKLPGVSLLKPLK
GVDPNLINNLETFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVG
INPKINNLMPGYEVAKYDLIWICDSGIRVIPDTLTDMVNQMTEKVGLVHGLPYVADRQGF
AATLEQVYFGTSHPRYYISANVTGFKCVTGMSCLMRKDVLDQAGGLIAFAQYIAEDYFMA
KAIADRGWRFAMSTQVAMQNSGSYSISQFQSRMIRWTKLRINMLPATIICEPISECFVAS
LIIGWAAHHVFRWDIMVFFMCHCLAWFIFDYIQLRGVQGGTLCFSKLDYAVAWFIRESMT
IYIFLSALWDPTISWRTGRYRLRCGGTAEEILDV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgctggacctggccttggagggaatggccgtcttcgggttcgtcctcttcttg
gtgctgtggctgatgcatttcatggctatcatctacacccgattacacctcaacaagaag
gcaactgacaaacagccttatagcaagctcccaggtgtctctcttctgaaaccactgaaa
ggggtagatcctaacttaatcaacaacctggaaacattctttgaattggattatcccaaa
tatgaagtgctcctttgtgtacaagatcatgatgatccagccattgatgtatgtaagaag
cttcttggaaaatatccaaatgttgatgctagattgtttataggtggcaaaaaagttggc
attaatcctaaaattaataatttaatgccaggatatgaagttgcaaagtatgatcttata
tggatttgtgatagtggaataagagtaattccagatacgcttactgacatggtgaatcaa
atgacagaaaaagtaggcttggttcacgggctgccttacgtagcagacagacagggcttt
gctgccaccttagagcaggtatattttggaacttcacatccaagatactatatctctgcc
aatgtaactggtttcaaatgtgtgacaggaatgtcttgtttaatgagaaaagatgtgttg
gatcaagcaggaggacttatagcttttgctcagtacattgccgaagattactttatggcc
aaagcgatagctgaccgaggttggaggtttgcaatgtccactcaagttgcaatgcaaaac
tctggctcatattcaatttctcagtttcaatccagaatgatcaggtggaccaaactacga
attaacatgcttcctgctacaataatttgtgagccaatttcagaatgctttgttgccagt
ttaattattggatgggcagcccaccatgtgttcagatgggatattatggtatttttcatg
tgtcattgcctggcatggtttatatttgactacattcaactcaggggtgtccagggtggc
acactgtgtttttcaaaacttgattatgcagtcgcctggttcatccgcgaatccatgaca
atatacatttttttgtctgcattatgggacccaactataagctggagaactggtcgctac
agattacgctgtgggggtacagcagaggaaatcctagatgtataa

DBGET integrated database retrieval system