KEGG   Homo sapiens (human): 941Help
Entry
941               CDS       T01001                                 

Gene name
CD80, B7, B7-1, B7.1, BB1, CD28LG, CD28LG1, LAB7
Definition
(RefSeq) CD80 molecule
  KO
K05412  CD80 antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04620  Toll-like receptor signaling pathway
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05320  Autoimmune thyroid disease
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06114  PI3K signaling (virus)
nt06169  Measles virus (MV)
  Element
N00683  CD80/CD86-CD28-PI3K signaling pathway
Drug target
Abatacept: D03203
Belatacept: D03222
Galiximab: D04295
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    941 (CD80)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    941 (CD80)
   04672 Intestinal immune network for IgA production
    941 (CD80)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    941 (CD80)
   05323 Rheumatoid arthritis
    941 (CD80)
   05320 Autoimmune thyroid disease
    941 (CD80)
   05330 Allograft rejection
    941 (CD80)
   05332 Graft-versus-host disease
    941 (CD80)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    941 (CD80)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    941 (CD80)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    941 (CD80)
CD molecules [BR:hsa04090]
 Proteins
  941 (CD80)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C2-set_2 V-set Ig_3 I-set ig Ig_2
Motif
Other DBs
NCBI-GeneID: 941
NCBI-ProteinID: NP_005182
OMIM: 112203
HGNC: 1700
Ensembl: ENSG00000121594
Vega: OTTHUMG00000159419
Pharos: P33681(Tclin)
UniProt: P33681 A0N0P2
LinkDB All DBs
Structure
PDB: 

Position
3q13.33
AA seq 288 aa AA seqDB search
MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELA
QTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLK
YEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGE
ELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFP
DNLLPSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgggccacacacggaggcagggaacatcaccatccaagtgtccatacctcaatttcttt
cagctcttggtgctggctggtctttctcacttctgttcaggtgttatccacgtgaccaag
gaagtgaaagaagtggcaacgctgtcctgtggtcacaatgtttctgttgaagagctggca
caaactcgcatctactggcaaaaggagaagaaaatggtgctgactatgatgtctggggac
atgaatatatggcccgagtacaagaaccggaccatctttgatatcactaataacctctcc
attgtgatcctggctctgcgcccatctgacgagggcacatacgagtgtgttgttctgaag
tatgaaaaagacgctttcaagcgggaacacctggctgaagtgacgttatcagtcaaagct
gacttccctacacctagtatatctgactttgaaattccaacttctaatattagaaggata
atttgctcaacctctggaggttttccagagcctcacctctcctggttggaaaatggagaa
gaattaaatgccatcaacacaacagtttcccaagatcctgaaactgagctctatgctgtt
agcagcaaactggatttcaatatgacaaccaaccacagcttcatgtgtctcatcaagtat
ggacatttaagagtgaatcagaccttcaactggaatacaaccaagcaagagcattttcct
gataacctgctcccatcctgggccattaccttaatctcagtaaatggaatttttgtgata
tgctgcctgacctactgctttgccccaagatgcagagagagaaggaggaatgagagattg
agaagggaaagtgtacgccctgtataa

DBGET integrated database retrieval system