KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497689
Entry
107497689         CDS       T06036                                 

Gene name
ADCY8
Definition
(RefSeq) adenylate cyclase type 8 isoform X1
  KO
K08048  adenylate cyclase 8 [EC:4.6.1.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00230  Purine metabolism
ray01100  Metabolic pathways
ray01522  Endocrine resistance
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04072  Phospholipase D signaling pathway
ray04114  Oocyte meiosis
ray04211  Longevity regulating pathway
ray04213  Longevity regulating pathway - multiple species
ray04261  Adrenergic signaling in cardiomyocytes
ray04270  Vascular smooth muscle contraction
ray04371  Apelin signaling pathway
ray04540  Gap junction
ray04611  Platelet activation
ray04713  Circadian entrainment
ray04714  Thermogenesis
ray04720  Long-term potentiation
ray04723  Retrograde endocannabinoid signaling
ray04724  Glutamatergic synapse
ray04725  Cholinergic synapse
ray04727  GABAergic synapse
ray04742  Taste transduction
ray04750  Inflammatory mediator regulation of TRP channels
ray04911  Insulin secretion
ray04912  GnRH signaling pathway
ray04913  Ovarian steroidogenesis
ray04914  Progesterone-mediated oocyte maturation
ray04915  Estrogen signaling pathway
ray04916  Melanogenesis
ray04918  Thyroid hormone synthesis
ray04921  Oxytocin signaling pathway
ray04923  Regulation of lipolysis in adipocytes
ray04925  Aldosterone synthesis and secretion
ray04926  Relaxin signaling pathway
ray04927  Cortisol synthesis and secretion
ray04928  Parathyroid hormone synthesis, secretion and action
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray04970  Salivary secretion
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray04976  Bile secretion
ray05032  Morphine addiction
ray05163  Human cytomegalovirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05200  Pathways in cancer
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107497689 (ADCY8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107497689 (ADCY8)
   04371 Apelin signaling pathway
    107497689 (ADCY8)
   04020 Calcium signaling pathway
    107497689 (ADCY8)
   04072 Phospholipase D signaling pathway
    107497689 (ADCY8)
   04024 cAMP signaling pathway
    107497689 (ADCY8)
   04022 cGMP-PKG signaling pathway
    107497689 (ADCY8)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107497689 (ADCY8)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107497689 (ADCY8)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107497689 (ADCY8)
   04062 Chemokine signaling pathway
    107497689 (ADCY8)
  09152 Endocrine system
   04911 Insulin secretion
    107497689 (ADCY8)
   04923 Regulation of lipolysis in adipocytes
    107497689 (ADCY8)
   04912 GnRH signaling pathway
    107497689 (ADCY8)
   04913 Ovarian steroidogenesis
    107497689 (ADCY8)
   04915 Estrogen signaling pathway
    107497689 (ADCY8)
   04914 Progesterone-mediated oocyte maturation
    107497689 (ADCY8)
   04921 Oxytocin signaling pathway
    107497689 (ADCY8)
   04926 Relaxin signaling pathway
    107497689 (ADCY8)
   04935 Growth hormone synthesis, secretion and action
    107497689 (ADCY8)
   04918 Thyroid hormone synthesis
    107497689 (ADCY8)
   04928 Parathyroid hormone synthesis, secretion and action
    107497689 (ADCY8)
   04916 Melanogenesis
    107497689 (ADCY8)
   04925 Aldosterone synthesis and secretion
    107497689 (ADCY8)
   04927 Cortisol synthesis and secretion
    107497689 (ADCY8)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107497689 (ADCY8)
   04270 Vascular smooth muscle contraction
    107497689 (ADCY8)
  09154 Digestive system
   04970 Salivary secretion
    107497689 (ADCY8)
   04971 Gastric acid secretion
    107497689 (ADCY8)
   04972 Pancreatic secretion
    107497689 (ADCY8)
   04976 Bile secretion
    107497689 (ADCY8)
  09156 Nervous system
   04724 Glutamatergic synapse
    107497689 (ADCY8)
   04727 GABAergic synapse
    107497689 (ADCY8)
   04725 Cholinergic synapse
    107497689 (ADCY8)
   04720 Long-term potentiation
    107497689 (ADCY8)
   04723 Retrograde endocannabinoid signaling
    107497689 (ADCY8)
  09157 Sensory system
   04742 Taste transduction
    107497689 (ADCY8)
   04750 Inflammatory mediator regulation of TRP channels
    107497689 (ADCY8)
  09149 Aging
   04211 Longevity regulating pathway
    107497689 (ADCY8)
   04213 Longevity regulating pathway - multiple species
    107497689 (ADCY8)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107497689 (ADCY8)
   04714 Thermogenesis
    107497689 (ADCY8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107497689 (ADCY8)
  09165 Substance dependence
   05032 Morphine addiction
    107497689 (ADCY8)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    107497689 (ADCY8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107497689 (ADCY8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107497689 (ADCY8)
   05163 Human cytomegalovirus infection
    107497689 (ADCY8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107497689 (ADCY8)
Enzymes [BR:ray01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     107497689 (ADCY8)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 TBK1_ULD
Other DBs
NCBI-GeneID: 107497689
NCBI-ProteinID: XP_015975308
LinkDB
Position
Unknown
AA seq 1251 aa
MELSDVRCLSGSEELYTIHPTPPAGDGGSGSRPQRLLWQTAVRHITEQRFIHGHRGGGGG
GGSAGSGKGSEPAGGPNHHASQLSSDSALPLYSLGPGERAHSAGSTKVFPERSGSGSASG
SGGGGDLGFLHLDCAPSNSDFFLSGGYSYRGVIFPTLRNSFKSRDLERLYQRYFLGQRRK
SEVVMNVLDVLTKLTLLVLHLSLASAPMDPLKGILLGFFTGIEVVICALVVVRKDTTSHT
YLQYSGVVTWVAMTTQIFAAGLGYGLLGDGIGYVLFTLFATYSMLPLPLAWAIVAGLGTS
LLQVVLQVVIPRLAVISINQVVAQAVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEAR
LRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADV
KGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDHAH
CCVEMGLGMIKTIRYVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKL
ESGGIPGRIHISKATLDCLGGDYKVEEGHGKERNEFLRKHDIETYLIKQPEESLLALPED
IVKESVSASDRRNSGATFVEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHV
QSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSNLVCAF
IVLLFITAIQSLLPSSRAMPMAIQFSILIMLHSALVLITTAEDYKCLPLVLRKTCCWINE
TYLARNVIIFASILINFLGAILNILWCDFDKSIPLKNLTFNSSAVFTDICSYPEYFVFTG
VLAMVTCAVFLRLNSVLKLAVLLIMIAVYALLTETIYAGLFLRYDHLTHSGEDFLGTKEA
SLLLMAMFLLAVFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVA
RHFLEKDRDNEELYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDE
LLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKH
SFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYAIL
KDQGFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRVPGQYSLAAVVLGLV
QSLNRQRQKQLLSENNSTGIIKGHYNRRTLLTPSGPEPGAQAEGADKSDLP
NT seq 3756 nt   +upstreamnt  +downstreamnt
atggagctctccgatgtgcgctgcctgagcggcagcgaggaactctacaccatccacccg
acgcccccggccggcgacggcgggagcggctctcggccgcagcggctgctctggcagacg
gcggtgcgacacatcaccgagcagcgcttcattcacgggcaccggggcggcggcggcggc
ggcgggagcgcaggctccggcaaaggctcggagccggcaggcggccccaaccaccacgct
tcgcagctgtccagcgactcggcgctgcccctttactcgctgggccccggggagcgagcg
cacagcgccggcagcaccaaagtcttccctgaacgcagtgggagcggcagcgccagcggc
agcgggggcgggggcgacctgggcttcctgcacctcgactgcgccccgagcaactcggat
ttcttcctcagtgggggctacagctaccgaggggtcatttttcccacgctgcgcaactcg
ttcaagtcccgggatctggagcgcctgtaccagcgctatttcctgggccagaggcgcaag
tccgaggtggtgatgaatgtgctggacgtgctgaccaaactcaccctgttggttctccac
ttgagcctggcctcggcccccatggacccgctcaagggcatcctgctgggcttcttcacg
ggcatcgaggtggtgatctgcgccctggtggtggtcaggaaggacaccacctcgcacacg
tacctgcagtacagcggcgtggtcacctgggtggccatgaccacccagatcttcgcagca
ggccttggctacgggcttctgggcgacggcatcggctacgtgctcttcacgctcttcgcc
acctacagcatgctgccgctgccgctcgcctgggccatcgtggcaggcctgggcacctcc
ttgctgcaggtggtcctccaagtggtcatcccccggctggcggtcatttccatcaaccag
gtggtggcccaggccgtgttattcatgtgtatgaacacagccggaatcttcatcagttac
ctgtcagaccgggcccagcgccaggccttcctggagacgcggaggtgtgtggaggccagg
ctgcgtctggagacagaaaaccaaagacaggagcggctcgtgctgtccgtgctgccccgg
tttgtcgtcctggaaatgatcaacgacatgaccaacgtggaggatgagcacctgcagcac
cagttccatcggatctacatccatcgctatgagaacgtcagtattctttttgcagacgtt
aaaggatttaccaacctctccacgaccttgtccgcccaggagctggtcaggatgctcaac
gagctctttgccagatttgatcgactggcccacgagcatcactgtcttcgcatcaaaatc
ctgggggactgctactactgcgtctccgggcttccggagccccgccaggaccacgcccac
tgctgtgtggaaatgggcctcggcatgatcaagaccatcaggtatgtgcggtcgaggacg
aagcatgacgttgacatgcggatcggaatccactccggctcggtgctgtgtggcgtgttg
ggccttcggaagtggcagtttgacgtctggtcttgggatgtggacatcgcgaacaaactc
gaatccggaggaatccctgggaggattcacatctccaaagccacactggactgccttggc
ggcgactataaggtggaggagggccacggcaaggagaggaacgagttcttgaggaagcac
gacatagagacctatttaattaagcagcccgaggagagcctgctggccctgcccgaagac
atcgtcaaggagtcggtgagcgcctcggaccggaggaacagtggggccaccttcgtcgaa
ggatcctggagccccgagctgcccttcgacaacatagtggggaaacagaacactctggct
gccctaacaagaaattcaataaatctacttccaaaccatcttgcacaagctttgcatgtc
cagtctgggcctgaggaaattaacaagagaatagaacataccatcgacttgcggagtggc
gataaattgagaagagagcatatcaagcctttctcactgatgtttaaagactccagcctg
gagcacaagtattctcaaatgagggacgaagttttcaagtcaaacttggtctgtgcgttt
atcgttctgctgtttatcacggcaatacaaagtttgcttccttcttcaagggcgatgccc
atggccatccagttttccatcctgatcatgctgcactcagctctggttctcatcaccacg
gcggaggattataagtgtctgcccctcgtcctccggaaaacttgctgttggatcaacgag
acctatttggcccggaacgtcatcattttcgcgtccatcttgatcaatttcctgggcgcc
atcctaaatatcctgtggtgtgattttgacaagtcgatccccttgaagaacctgactttc
aattcctcagctgtgtttacagatatctgctcctacccagagtacttcgtcttcacaggg
gtgttggccatggtgacctgtgcggtgttcctccgacttaactccgtcctcaagctggcc
gtgctgctgatcatgatcgccgtctacgccctgctgaccgagaccatctacgcagggctc
tttctgcgctatgaccacctgacccacagtggagaggatttcctggggaccaaggaggcg
tcgctgctgctgatggccatgttcctccttgccgtgttctaccatggacagcagctggag
tacacggcccgcctggacttcctctggcgcgttcaggccaaggaggagatcaacgagatg
aaggagctgagggagcacaacgagaacatgctgcgcaacatcctgcccagccacgtggcc
cgccacttcctggagaaggaccgggacaacgaggagctgtattctcagtcctacgatgct
gtcggggtgatgttcgcctccatcccggggttcgcggacttctactctcagaccgagatg
aacaaccagggagtggaatgcctgcgccttctgaacgagatcatcgccgacttcgatgag
ctgctcggcgaagaccggtttcaagacatcgagaagatcaagaccatcggcagcacctac
atggccgtgtcgggcctgtcacctgaaaaacagcaatgtgaagacaagtggggacacttg
tgtgccctggccgacttctctctcgcgctgaccgagagcatacaggagatcaacaagcat
tcgttcaacaacttcgaactccggatcggcatcagccacggctccgtggtggccggcgtc
atcggcgctaagaaaccgcagtacgacatctggggcaaaaccgtgaacctggccagtcgg
atggacagcacgggggtcagcggcaggatccaggtcccagaggagacctacgccatcctg
aaggaccagggctttgccttcgactaccgaggggagatctacgtgaagggcatcagcgag
caggaaggcaagatcaaaacatactttctcctgggcagggtccagcccaacccgttcatc
ctgcccccgagaagggtgcccgggcagtactccttggccgccgtcgtcctgggcctcgtc
cagtccctcaacaggcagaggcagaagcagctgctcagcgagaacaacagcacgggcatc
atcaagggccattacaaccggcggactttgctcacccccagcgggccggagcctggcgcc
caggccgagggcgccgacaagtccgatttgccataa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498014
Entry
107498014         CDS       T06036                                 

Gene name
ADCY4
Definition
(RefSeq) LOW QUALITY PROTEIN: adenylate cyclase type 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00230  Purine metabolism
ray01100  Metabolic pathways
ray01522  Endocrine resistance
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04072  Phospholipase D signaling pathway
ray04114  Oocyte meiosis
ray04211  Longevity regulating pathway
ray04213  Longevity regulating pathway - multiple species
ray04261  Adrenergic signaling in cardiomyocytes
ray04270  Vascular smooth muscle contraction
ray04371  Apelin signaling pathway
ray04540  Gap junction
ray04611  Platelet activation
ray04713  Circadian entrainment
ray04714  Thermogenesis
ray04723  Retrograde endocannabinoid signaling
ray04724  Glutamatergic synapse
ray04725  Cholinergic synapse
ray04727  GABAergic synapse
ray04742  Taste transduction
ray04750  Inflammatory mediator regulation of TRP channels
ray04911  Insulin secretion
ray04912  GnRH signaling pathway
ray04913  Ovarian steroidogenesis
ray04914  Progesterone-mediated oocyte maturation
ray04915  Estrogen signaling pathway
ray04916  Melanogenesis
ray04918  Thyroid hormone synthesis
ray04921  Oxytocin signaling pathway
ray04923  Regulation of lipolysis in adipocytes
ray04925  Aldosterone synthesis and secretion
ray04926  Relaxin signaling pathway
ray04927  Cortisol synthesis and secretion
ray04928  Parathyroid hormone synthesis, secretion and action
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray04970  Salivary secretion
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray04976  Bile secretion
ray05032  Morphine addiction
ray05163  Human cytomegalovirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05200  Pathways in cancer
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107498014 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107498014 (ADCY4)
   04371 Apelin signaling pathway
    107498014 (ADCY4)
   04020 Calcium signaling pathway
    107498014 (ADCY4)
   04072 Phospholipase D signaling pathway
    107498014 (ADCY4)
   04024 cAMP signaling pathway
    107498014 (ADCY4)
   04022 cGMP-PKG signaling pathway
    107498014 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107498014 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107498014 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107498014 (ADCY4)
   04062 Chemokine signaling pathway
    107498014 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    107498014 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    107498014 (ADCY4)
   04912 GnRH signaling pathway
    107498014 (ADCY4)
   04913 Ovarian steroidogenesis
    107498014 (ADCY4)
   04915 Estrogen signaling pathway
    107498014 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    107498014 (ADCY4)
   04921 Oxytocin signaling pathway
    107498014 (ADCY4)
   04926 Relaxin signaling pathway
    107498014 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    107498014 (ADCY4)
   04918 Thyroid hormone synthesis
    107498014 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    107498014 (ADCY4)
   04916 Melanogenesis
    107498014 (ADCY4)
   04925 Aldosterone synthesis and secretion
    107498014 (ADCY4)
   04927 Cortisol synthesis and secretion
    107498014 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107498014 (ADCY4)
   04270 Vascular smooth muscle contraction
    107498014 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    107498014 (ADCY4)
   04971 Gastric acid secretion
    107498014 (ADCY4)
   04972 Pancreatic secretion
    107498014 (ADCY4)
   04976 Bile secretion
    107498014 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    107498014 (ADCY4)
   04727 GABAergic synapse
    107498014 (ADCY4)
   04725 Cholinergic synapse
    107498014 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    107498014 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    107498014 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    107498014 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    107498014 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    107498014 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107498014 (ADCY4)
   04714 Thermogenesis
    107498014 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107498014 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    107498014 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    107498014 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107498014 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107498014 (ADCY4)
   05163 Human cytomegalovirus infection
    107498014 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107498014 (ADCY4)
Enzymes [BR:ray01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     107498014 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 107498014
NCBI-ProteinID: XP_015976043
LinkDB
Position
Unknown
AA seq 1077 aa
MPRLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLVIVLSTLLALLAVAWASGRELASDRG
FLTTVLCALGGFSLLLGLASREQRLQRWTRPLSGLVWVALLALGHGFLFTGGVVSAWDQV
SFFIFVIFTTYAMLPLGMRDAAAAGLTSSLSHLLVLGLYLGPQPDSRPALLPQLAANAVL
FLCGNVAGAYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
AEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
AYAVEDVAMEHRDPYLRELGETTYLVIDPRAEEEDEKGTAGGLLSSLEGPKMRPSLLMTR
YLESWGAAKPFAHLSHVESPVSTSTPLPEKALASFSPQWSLDRSRTPRGLDDELDTGDAK
FFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSALPAFRYYAACTFLVFLSNFI
IQMLVTNRPPALAITYSITFLLFLLLLFACFSEHLTRCVLKGPKMLHWLPALSGLVATRP
GLRVALGTATILLVFSMAITSLFFLPAASNCPFPAPNVSSEAFNLSWELPGSLPLISIPY
SMHCCVLGSLSCSLFLHMSFELKLLLLLLWLVASCSLFLHSHAWLSDCLVARLYLGSLDS
RPGVLKEPKLMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETEMMENLTRL
LLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLR
LLNEIIADFDELLSKPKFSGVEKIKTICSTYMAATGLNATSGQDAQQDAERSCSHLGTMV
EFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMEST
GVLGKIQVTEETARALQSLGYICYSRGVIKVKGKGQLCTYFLNTDLTRAGPPSATLG
NT seq 3234 nt   +upstreamnt  +downstreamnt
atgcctcgcctcttcagtccccggccaccgcccagcgaagacctcttctatgagacctac
tacagcttgagccagcagtacccactgctgctactgctgctggtgatcgtgctctccacg
ctcctggcattgctagctgtcgcctgggccagcggcagggagctggcttcggacaggggc
ttcctgaccacagtgctgtgcgcgctgggagggttctcgctgctgctgggcctggcttcc
cgcgagcagcgactgcagcgctggactcgtcccctctccggcctcgtgtgggtagcgtta
ctcgcgctaggccacggcttcctgttcaccggaggcgtagtgagcgcctgggaccaggtg
tcctttttcatctttgtcatcttcaccacgtatgccatgctgcccttgggcatgcgggac
gccgccgccgcgggcctcacttcatcgctctcacacctgctggtcctcgggctgtatctt
gggcctcagccagactcacgaccggcgctgctgcctcagctggcagcaaacgccgtgctc
ttcctgtgcgggaacgtggccggggcgtatcacaaagcgctgatggagcgggcgctgcgc
gccaccttccgagaggcgcttagttccctgcactctcgccggaggctggacaccgagaag
aagcatcaggaacaccttctcttgtccatccttcctgcctacttggcccgagagatgaag
gcggagatcatggcaaggctgcaggctggacaggggtcacggccagagagcaccaacaac
ttccacagcctttatgtaaagaggcaccagggagtcagcgtgctgtatgctgacatcgtg
ggcttcacgcggctggcaagtgaatgctccccaaaggagttggtgctcatgctcaacgag
ctctttggcaagttcgaccagattgccaaggagcatgaatgcatgcggatcaagatcctg
ggagactgttactactgtgtctctgggctgccgctctcgctgccagaccacgccatcaac
tgtgtgcgcatggggctggacatgtgccgggccatcagaaaattgcgggcagccaccggt
gttgatatcaacatgcgcgtgggcgtgcactcgggcagcgtgctctgtggagtcatcggg
ctgcagaagtggcagtatgatgtgtggtcccatgatgtcacactggccaaccacatggag
gcaggtggcgtgccaggacgagtgcatatcacaggggctactctggccctgctggcagga
gcttacgctgtggaggatgtagccatggaacaccgggacccataccttcgagagctaggg
gagactacctacctggtcatcgatccccgggccgaggaggaggatgagaagggcactgcg
ggagggttgctatcctctctcgaaggtcccaagatgcgtccatcactgctgatgacccgc
tatctggagtcctggggtgcagccaagccttttgcgcatctgagccacgtagagagccct
gtgtccacctccacccctctgccggagaaagccctggcttccttcagcccccagtggagc
ctggaccggagccgtaccccccggggactagatgatgaactggacaccggggatgccaag
ttcttccaggtcatcgaacagctcaactctcagaaacagtggaagcagtcaaaggacttc
aacccactgacattgtacttccgagagaaggagatggagaaagagtatcgactctccgca
ctccctgccttcagatactacgcagcctgcaccttcctggtttttctctccaacttcatc
atccagatgctggtgacaaacaggcccccagctctggccatcacctatagcatcaccttc
ctcctcttcctcctcctcctcttcgcctgcttctcagagcacctgacgaggtgtgtcttg
aaaggccccaagatgctgcactggctgcccgcgctgtctggcctggtggccacacggccc
ggactgcgggttgccctgggcactgccaccatcctccttgtcttttccatggccattacc
agcctgttcttcttaccagcagcatcgaactgccctttcccggcgcccaatgtgtcctct
gaggctttcaacctctcctgggagctccctgggtccttgcctctcatcagcatcccatac
tccatgcactgctgtgtgctgggttccctctcctgctccctctttctgcacatgagcttt
gaactgaagctgctgctgctcctgctgtggctggtggcctcctgctccctcttcctgcat
tcgcacgcctggctgtcggattgcctcgttgcccgcctctatctcggctccttagactcc
aggccaggggtgctcaaggagcccaaactcatgggagctatctccttcttcatcttcttc
ttcacactccttgtcttggctcggcagaatgagtattattgccgcctggacttcctgtgg
aagaagaagctgaggcaggagagggaggagacagagatgatggagaacctgactcggctg
ctcttggaaaacgtgcttccagcgcacgtggccccccagttcattggccagaaccggcgc
aatgaggacctctaccaccagtcctacgagtgtgtctgcgtcctcttcgcctcagtccca
gactttaaggagttttactctgaatctaacatcaaccatgaggggctagagtgtctgcgg
ctgctcaatgagatcattgctgatttcgatgagctgctctctaagcccaagttcagtggg
gtggaaaagatcaaaacgatttgcagcacctacatggcagctacaggcttaaatgccacc
tctggacaggacgcacagcaggatgctgagcgaagctgcagccaccttggcaccatggtg
gagtttgcggtggcccttgggtctaagctggatgtcatcaacaagcactcattcaacaac
ttccgcctgcgtgtgggattgaaccacggacctgtggtggctggagtaataggggcccag
aagccacaatatgacatctggggtaacacagtgaatgtggccagccgcatggagagtaca
ggagtcctgggcaagatccaagtgactgaggagacagcccgtgccctgcagtccttaggt
tacatttgctacagccggggtgtcatcaaggtcaaaggcaaagggcaactgtgcacctac
ttcctgaacacggatttgacacgagctggacctccttcagccaccctgggctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498506
Entry
107498506         CDS       T06036                                 

Gene name
ADCY3
Definition
(RefSeq) LOW QUALITY PROTEIN: adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00230  Purine metabolism
ray01100  Metabolic pathways
ray01522  Endocrine resistance
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04072  Phospholipase D signaling pathway
ray04114  Oocyte meiosis
ray04211  Longevity regulating pathway
ray04213  Longevity regulating pathway - multiple species
ray04261  Adrenergic signaling in cardiomyocytes
ray04270  Vascular smooth muscle contraction
ray04371  Apelin signaling pathway
ray04540  Gap junction
ray04611  Platelet activation
ray04713  Circadian entrainment
ray04714  Thermogenesis
ray04723  Retrograde endocannabinoid signaling
ray04724  Glutamatergic synapse
ray04725  Cholinergic synapse
ray04727  GABAergic synapse
ray04740  Olfactory transduction
ray04750  Inflammatory mediator regulation of TRP channels
ray04911  Insulin secretion
ray04912  GnRH signaling pathway
ray04913  Ovarian steroidogenesis
ray04914  Progesterone-mediated oocyte maturation
ray04915  Estrogen signaling pathway
ray04916  Melanogenesis
ray04918  Thyroid hormone synthesis
ray04921  Oxytocin signaling pathway
ray04923  Regulation of lipolysis in adipocytes
ray04925  Aldosterone synthesis and secretion
ray04926  Relaxin signaling pathway
ray04927  Cortisol synthesis and secretion
ray04928  Parathyroid hormone synthesis, secretion and action
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray04962  Vasopressin-regulated water reabsorption
ray04970  Salivary secretion
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray04976  Bile secretion
ray05032  Morphine addiction
ray05163  Human cytomegalovirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05200  Pathways in cancer
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107498506 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107498506 (ADCY3)
   04371 Apelin signaling pathway
    107498506 (ADCY3)
   04020 Calcium signaling pathway
    107498506 (ADCY3)
   04072 Phospholipase D signaling pathway
    107498506 (ADCY3)
   04024 cAMP signaling pathway
    107498506 (ADCY3)
   04022 cGMP-PKG signaling pathway
    107498506 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107498506 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107498506 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107498506 (ADCY3)
   04062 Chemokine signaling pathway
    107498506 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    107498506 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    107498506 (ADCY3)
   04912 GnRH signaling pathway
    107498506 (ADCY3)
   04913 Ovarian steroidogenesis
    107498506 (ADCY3)
   04915 Estrogen signaling pathway
    107498506 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    107498506 (ADCY3)
   04921 Oxytocin signaling pathway
    107498506 (ADCY3)
   04926 Relaxin signaling pathway
    107498506 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    107498506 (ADCY3)
   04918 Thyroid hormone synthesis
    107498506 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    107498506 (ADCY3)
   04916 Melanogenesis
    107498506 (ADCY3)
   04925 Aldosterone synthesis and secretion
    107498506 (ADCY3)
   04927 Cortisol synthesis and secretion
    107498506 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107498506 (ADCY3)
   04270 Vascular smooth muscle contraction
    107498506 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    107498506 (ADCY3)
   04971 Gastric acid secretion
    107498506 (ADCY3)
   04972 Pancreatic secretion
    107498506 (ADCY3)
   04976 Bile secretion
    107498506 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107498506 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    107498506 (ADCY3)
   04727 GABAergic synapse
    107498506 (ADCY3)
   04725 Cholinergic synapse
    107498506 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    107498506 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    107498506 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    107498506 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    107498506 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    107498506 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107498506 (ADCY3)
   04714 Thermogenesis
    107498506 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107498506 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    107498506 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    107498506 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107498506 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107498506 (ADCY3)
   05163 Human cytomegalovirus infection
    107498506 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107498506 (ADCY3)
Enzymes [BR:ray01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     107498506 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA Peptidase_S49_N
Other DBs
NCBI-GeneID: 107498506
NCBI-ProteinID: XP_015977196
LinkDB
Position
Unknown
AA seq 1146 aa
MPRNQGFSDPEYSAEYSAEYSVSLPSDPERGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSRDQLAPLVAAGIWLLLDVI
LFVLCKKGLLPVRVTRKVVPYLLWLLITAQIFSYLGLNFAGAHAASDTVGWQAFFVFSFF
ITLPLSLSPIVVISVVSCVVHTLVLGVTVAQQQQDGLKGMRLLREILASVFLYLGAIIVG
ITSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTLDCLKGFEFDVEPGDGGSRC
DYLDEKGIETYLVIASKPEVKKTAVQNGLNGSALPNGAPPSSQPSSPALIETKEPNGSVH
ASGSTSDEPEEQGAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERES
AQVVKKRNTFLLSMRFMEPEMETRYSVEKEKQSGAAFSCSCVVLLCAALAEMLIDPWLMT
NYVTFVVGEVLLLILTICSLAAIFPQAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMA
NVVDMLSCLQFYAGPSNGTAGTGVEDGCAANPEYYDDVAVLSLVATIMLVQVSHMVKLTL
MLLIAGAVAVVNIYAWRPIFDEYDRRRFQEHDFPVVALEKMQILSTAGLNGTDRLPLLPS
KYSMTAMIFVMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPE
HVARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISD
FDSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTSSNKEEKSDKERWQHLADLAD
FALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTG
VMGNIQVVEDTQAILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKPATFPNGSSVTLPH
QVVDNS
NT seq 3441 nt   +upstreamnt  +downstreamnt
atgccgaggaaccagggcttctccgaccccgagtactcggccgagtactccgccgagtac
tccgtcagcctaccctctgacccggagcgcggggtgggccggacccatgaaatctctgtg
cggaactcggggtcctgcctctgcctgcctcgctttatgcggctgaccttcgtgcccgag
tccttggagaacctgtaccagacctatttcaaaaggcagcgccacgagaccctgctggtg
ctggtggtcttcgcagccctcttcgactgctacgtggtggtcatgtgcgccgtggtcttc
tcccgcgaccagctggctcccctcgtggcggctgggatctggctgctgttggatgtcatc
ctcttcgtgctctgcaaaaaggggctgctcccggtccgggtcacccggaaagtggtgccc
tacctactgtggctgctgataacggcccagatcttctcctacttgggcctgaacttcgcc
ggcgcccacgcagccagcgacacggtgggctggcaggccttctttgtcttctccttcttc
atcacgctgcccctcagcctcagccccatcgtggtcatctctgtggtctcctgtgtggtg
cacacgctcgtcttgggggtcaccgtggcccagcagcagcaggatgggctgaaggggatg
cggttgctgagagagatcctggccagtgtctttctgtacctcggcgccatcatcgtgggc
atcacgtcctactacatggcagaccgcaagcaccgcaaggccttcctggaggcccgccag
tcgctggaggtgaagatgaacctggaggagcagagccagcagcaggagaaccttatgctc
tccatcctgcccaagcacgtggctgacgagatgctcaaggacatgaagaaggacgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccggcacgagaacgtcagcatc
ctgttcgcggacatcgtgggcttcacccagctgtcctctgcctgcagcgcacaggagctc
gtgaagctgctcaacgagctcttcgcccgtttcgacaagctggcggccaaatatcaccag
ctgaggatcaagatcctgggcgactgttactattgcatctgtggcctgcccgactaccgc
gaggaccacgccgtctgctccatcctcatggggctcgccatggtggaggccatctcgtat
gtgcgagagaagacgaagaccggggtggacatgcgtgtgggggtgcacacgggcaccgtg
ctgggcggcgtcctgggccagaagcgctggcagtacgacgtgtggtccactgacgtgacc
gtggccaacaagatggaggccggcggcatccccgggcgtgtgcacatctcacagagcacc
ttggactgcctgaaggggttcgagttcgacgtggagccgggcgacgggggcagccgctgc
gattacctggatgagaagggcatcgaaacctacctcgtcatcgcctccaagccagaggtg
aagaaaacggccgtccaaaatggcctcaatggctcggccctgcccaatggagccccccct
tcctcgcagcccagctcccccgccctcatcgagaccaaggagcccaacgggagtgtccac
gccagcgggtccacgtcggacgagcccgaggagcaaggggcccaggccgacaacccctcc
ttccccaaccctcgccggaggctgcgcctccaggacctggccgaccgcgtggtcgacgcc
tccgaggacgagcatgagctcaaccagctgctcaacgaggcgctgctcgagcgggagtcc
gcccaggtagtgaagaagaggaacaccttcctcctgtccatgcggttcatggagcccgag
atggagacgcgctactcggtggagaaggagaagcagagtggggccgccttcagctgctcc
tgcgtcgtcctgctctgcgcggccctggccgagatgctcatcgacccctggctaatgaca
aactacgtgacctttgtggttggggaagttctgcttctgatcctgacgatctgctcgctg
gctgccatctttccccaggcctttcctaagaagctcgtggccttctcaacttggatcgac
cggacccgctgggccaggaacacctgggccatgttagccatcttcattctggttatggca
aatgtcgtggacatgctcagctgcctccagttctacgcgggacccagcaacggcaccgca
gggacgggggtggaggacggctgcgcggcgaaccccgagtattacgacgacgtcgccgtg
ctgtcgctcgtggccaccatcatgctggtgcaggtcagccacatggtgaagctcacgctc
atgctgctcatcgccggcgccgtggccgtcgtcaacatctacgcctggcgccccatcttt
gacgaatacgaccgcaggcgtttccaggagcacgactttcctgtggttgccttggagaag
atgcagatactctccaccgctgggctcaacggcactgacaggctgcccctgctgccctcc
aagtactcgatgacagcgatgatcttcgtcatgatgctgagcttttactacttctcccgc
cacgtggaaaaactggctcggacactgttcttatggaagatcgaggtccatgaccagaag
gaacgtgtctacgagatgcgacgctggaacgaggccctggtcaccaacatgttgcctgag
cacgtggcgcgccatttcctggggtccaagaagagagacgaggaactgtacagccagtct
tatgacgagattggagtcatgtttgcctccctgcccaactttgctgacttctacacagag
gagagcatcaataatggtggcattgagtgtctgcgctttctcaacgagatcatctcagac
tttgactctctcctggacaatcccaaattccgggtcatcaccaagatcaaaaccattggc
agtacctatatggcagcttcaggagtcaccccagatgtcaacaccaatggctttaccagc
tccaacaaggaggagaagtccgacaaggagcgctggcagcacctggccgatctggctgac
ttcgcactagccatgaaggatacgctcaccaacatcaacaaccagtccttcaacaacttc
atgctgcgcataggcatgaacaaaggaggggtactggctggggtcattggagcccggaaa
ccacattatgacatctggggcaacacagtcaacgtagccagcaggatggagtccacaggc
gtcatgggcaacattcaggtggtagaagacacacaggccatcctccgagagtatggcttc
cgcttcgtgaggcgagggcccatctttgtgaaagggaaaggggagctgctaacctttttc
ttgaagggccgtgacaagccagccaccttccctaacggctcctctgtcacactgccccac
caggtggtagacaactcctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107502700
Entry
107502700         CDS       T06036                                 

Gene name
ADCY2
Definition
(RefSeq) LOW QUALITY PROTEIN: adenylate cyclase type 2
  KO
K08042  adenylate cyclase 2 [EC:4.6.1.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00230  Purine metabolism
ray01100  Metabolic pathways
ray01522  Endocrine resistance
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04072  Phospholipase D signaling pathway
ray04114  Oocyte meiosis
ray04211  Longevity regulating pathway
ray04213  Longevity regulating pathway - multiple species
ray04261  Adrenergic signaling in cardiomyocytes
ray04270  Vascular smooth muscle contraction
ray04371  Apelin signaling pathway
ray04540  Gap junction
ray04611  Platelet activation
ray04713  Circadian entrainment
ray04714  Thermogenesis
ray04723  Retrograde endocannabinoid signaling
ray04724  Glutamatergic synapse
ray04725  Cholinergic synapse
ray04727  GABAergic synapse
ray04750  Inflammatory mediator regulation of TRP channels
ray04911  Insulin secretion
ray04912  GnRH signaling pathway
ray04913  Ovarian steroidogenesis
ray04914  Progesterone-mediated oocyte maturation
ray04915  Estrogen signaling pathway
ray04916  Melanogenesis
ray04918  Thyroid hormone synthesis
ray04921  Oxytocin signaling pathway
ray04922  Glucagon signaling pathway
ray04923  Regulation of lipolysis in adipocytes
ray04925  Aldosterone synthesis and secretion
ray04926  Relaxin signaling pathway
ray04927  Cortisol synthesis and secretion
ray04928  Parathyroid hormone synthesis, secretion and action
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray04970  Salivary secretion
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray04976  Bile secretion
ray05032  Morphine addiction
ray05163  Human cytomegalovirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05200  Pathways in cancer
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107502700 (ADCY2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107502700 (ADCY2)
   04371 Apelin signaling pathway
    107502700 (ADCY2)
   04020 Calcium signaling pathway
    107502700 (ADCY2)
   04072 Phospholipase D signaling pathway
    107502700 (ADCY2)
   04024 cAMP signaling pathway
    107502700 (ADCY2)
   04022 cGMP-PKG signaling pathway
    107502700 (ADCY2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107502700 (ADCY2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107502700 (ADCY2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107502700 (ADCY2)
   04062 Chemokine signaling pathway
    107502700 (ADCY2)
  09152 Endocrine system
   04911 Insulin secretion
    107502700 (ADCY2)
   04922 Glucagon signaling pathway
    107502700 (ADCY2)
   04923 Regulation of lipolysis in adipocytes
    107502700 (ADCY2)
   04912 GnRH signaling pathway
    107502700 (ADCY2)
   04913 Ovarian steroidogenesis
    107502700 (ADCY2)
   04915 Estrogen signaling pathway
    107502700 (ADCY2)
   04914 Progesterone-mediated oocyte maturation
    107502700 (ADCY2)
   04921 Oxytocin signaling pathway
    107502700 (ADCY2)
   04926 Relaxin signaling pathway
    107502700 (ADCY2)
   04935 Growth hormone synthesis, secretion and action
    107502700 (ADCY2)
   04918 Thyroid hormone synthesis
    107502700 (ADCY2)
   04928 Parathyroid hormone synthesis, secretion and action
    107502700 (ADCY2)
   04916 Melanogenesis
    107502700 (ADCY2)
   04925 Aldosterone synthesis and secretion
    107502700 (ADCY2)
   04927 Cortisol synthesis and secretion
    107502700 (ADCY2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107502700 (ADCY2)
   04270 Vascular smooth muscle contraction
    107502700 (ADCY2)
  09154 Digestive system
   04970 Salivary secretion
    107502700 (ADCY2)
   04971 Gastric acid secretion
    107502700 (ADCY2)
   04972 Pancreatic secretion
    107502700 (ADCY2)
   04976 Bile secretion
    107502700 (ADCY2)
  09156 Nervous system
   04724 Glutamatergic synapse
    107502700 (ADCY2)
   04727 GABAergic synapse
    107502700 (ADCY2)
   04725 Cholinergic synapse
    107502700 (ADCY2)
   04723 Retrograde endocannabinoid signaling
    107502700 (ADCY2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107502700 (ADCY2)
  09149 Aging
   04211 Longevity regulating pathway
    107502700 (ADCY2)
   04213 Longevity regulating pathway - multiple species
    107502700 (ADCY2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107502700 (ADCY2)
   04714 Thermogenesis
    107502700 (ADCY2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107502700 (ADCY2)
  09165 Substance dependence
   05032 Morphine addiction
    107502700 (ADCY2)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    107502700 (ADCY2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107502700 (ADCY2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107502700 (ADCY2)
   05163 Human cytomegalovirus infection
    107502700 (ADCY2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107502700 (ADCY2)
Enzymes [BR:ray01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     107502700 (ADCY2)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N HNOBA
Other DBs
NCBI-GeneID: 107502700
NCBI-ProteinID: XP_015985631
LinkDB
Position
Unknown
AA seq 1091 aa
MWQEAMRRRRYLRDRAEAAAGGGDGPPRSRDWLYESYYCLSQQHPLIVFLLLIVMGACLA
LLVVFFALRLEVKDHVAFLITVPTALAIFFAIFILVCIESVFRKLLRLFSVVIWLCLVAM
AHLFMCFGGTVSPWDQVSFFLFVVFVVYTMLPFSMRDAVIASTLTSSSHTIVLSVCLSAT
PGAKEHLVWQILANVIIFICGNLAGAYHKHLMELALQQTYQDTCNCIKSRIKLEFEKRQQ
ERLLLSLLPAHIAMEMKAEIIQRLQGPKAGHMENTNNFHNLYVKRHTNVSILYADIVGFT
RLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPISLPNHAKNCVK
MGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGG
VPGRVHISSVTLEHLNGAYKVEEGDGDIRDPYLKQHLVKTYFVINPKGERRSPQHLFRPR
HTLDGAKMRASVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTMDVPMGQHNFQNRTL
RTKSQKKRFEEELNERMIQAIDGINAQKQWLKSEDIQRISLLFYNKILEKEYRATALPAF
KYYVTCACLIFFCIFVVQILVLPKTSALGISFGAASLSLAFILFVCFAGQLLQCSKKASA
SLLWLLKSSGVIANRPWPQISLTVITTAIVLTMAVLNMFFLSDPEEAVPPATNTSNASLS
ASHRQAAILRAQNLFFLPYFIYSCILGLISCSVFLRVNYELKMSIMTAALVGYNTVFLHT
HAHVLDSYSQVLFERPGIWKDLKTMGSVSLSIFFVTLLVLGRQNEYYCRLDFLWKNKFKK
EREEIETMENLNRVLLENVLPAHVAEHFLARSLKNEDLYHQSYACVCVMFASIPDFKEFY
TESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAVPSQEHA
QEPERQYTHIGTMVEFAFALGAKLTAINKHSFNDFKLRVGMNHGPVIAGVIGAQKPQYDI
WGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGELKTYFVSTEM
SGSLSQSNLAA
NT seq 3276 nt   +upstreamnt  +downstreamnt
atgtggcaggaggcgatgcggcgccgccgctacctgcgggaccgcgccgaggcggcggcg
ggcggcggcgacgggccgccgcggtcccgcgactggctgtacgagtcctactactgcctg
agccagcagcacccgctcatcgtcttcctgctgctcatcgtcatgggcgcctgcctcgcg
ctgctcgtcgtcttcttcgcgctgcggctggaagtcaaagaccacgtggcgtttttaatc
acggtccccaccgccctggccatcttcttcgcgatcttcatcctcgtgtgcatcgagtcc
gtgttcaggaagctgctccgcctcttctccgtggtcatctggctgtgcctggtcgccatg
gcgcacctgttcatgtgcttcgggggcaccgtctctccctgggaccaggtgtccttcttc
ctcttcgtcgtcttcgtggtgtacaccatgctgcccttcagcatgcgggacgccgtcatc
gccagcacgctcacctcatcctcccacaccatcgtgctgagcgtctgcctgtctgcaacg
cccggggccaaggagcacctggtctggcagatcctggccaacgtgatcatcttcatctgc
gggaatctggcgggcgcgtaccacaagcacctcatggagctcgccctgcagcagacctat
caggacacctgcaactgcatcaagtcccgaatcaagctggaattcgagaagcggcagcag
gagcggcttctgctctccctgctgccggcccacatagccatggagatgaaggccgagatc
atccagcggctccagggccccaaagccggccacatggaaaacacgaacaacttccacaac
ctgtacgtcaagcgacacaccaacgtcagtatcctgtacgccgacattgtggggttcacc
cggctggccagtgactgctccccaggagagctggtccacatgctgaatgaactctttggg
aaattcgatcaaattgcgaaggagaacgaatgcatgaggataaaaattttaggcgactgc
tactactgcgtgtccggactcccgatctccctccctaaccacgccaagaactgcgtgaaa
atggggctggacatgtgtgaagccataaagaaagtgagggacgcgacgggggtcgacatc
aacatgcgcgtgggggtgcactcggggaacgtcctgtgcggcgtgatcggcctgcagaag
tggcagtacgacgtgtggtcccacgacgtcaccttggccaaccacatggaagccggcggg
gtccccggacgtgtccacatttcgtctgtcaccctggagcacctgaatggggcttataaa
gtggaggaaggggacggtgacatcagggacccatacttaaagcagcacctggtgaaaacc
tacttcgtaatcaaccccaagggagagcgacggagcccgcagcacctgttcagacctcgc
cacacgctcgacggggccaagatgagggcgtccgtgcgcatgacgcggtacctggagtcg
tggggggccgccaagcccttcgcccacctgcaccaccgggacagcatgaccacggagaac
ggcaagatcagcaccatggatgtgccgatgggtcagcataattttcaaaaccgcacctta
agaaccaagtcacaaaagaaaaggtttgaagaagaattgaatgaaaggatgattcaagca
attgatggaattaatgcacaaaagcaatggctcaagtctgaagacattcaaagaatctca
ctgcttttctacaataaaatactagaaaaagagtaccgagccacggcgctgcccgccttc
aagtactacgtgacctgcgcgtgcctcattttcttctgcatcttcgtcgtgcagattctc
gtgttgccgaagacgtccgctctcggcatctccttcggggccgcgtccctctcgctcgcc
ttcatcctgttcgtctgcttcgccggacagctcctgcaatgcagcaaaaaggcctctgcc
tccctcctgtggctgttgaagtcctcgggtgtcatcgcgaaccgcccgtggccgcagatc
tcgctcacggtcatcaccacggcgatcgtcctaaccatggccgtcctcaacatgtttttc
ctgagcgacccagaggaagccgtccctcccgccaccaacacgtcgaacgcgagcctctct
gcctcgcaccgccaggcggccatcctgcgcgcgcagaacctgtttttcctcccgtacttc
atctacagctgcattctggggctgatatcctgctccgtgttcctgcgggtgaactacgag
ctgaaaatgtccatcatgacggcggcgctggtgggctacaacaccgtcttcctccacacc
cacgcccacgtcctggacagctacagccaggtcctgtttgagagaccaggcatttggaaa
gacttaaagaccatgggctcggtgtccctctccatcttcttcgtcacactgctcgttctg
ggcagacagaatgaatattactgtaggttagacttcttgtggaagaacaagttcaaaaaa
gagcgggaggagatagagaccatggagaacctgaaccgcgtgctgctggagaacgtgctc
cccgcccacgtggccgagcacttcctggccaggagcctgaagaacgaggacttgtaccac
cagtcctacgcctgcgtctgcgtgatgttcgcctccatcccggacttcaaggagttctac
accgagtcggacgttaacaaggagggcttggagtgcctgcggctcctcaacgagatcatc
gccgacttcgacgacctgctgtccaagccgaaattcagcggggtggaaaagatcaagacc
atcgggagcacgtacatggccgcgacgggcctgagcgccgtgcccagccaggagcacgcc
caggagcccgagcgccagtacacgcacatcggcaccatggtggagttcgccttcgcgctg
ggggccaagctgaccgccatcaacaagcactccttcaacgacttcaagctgcgcgtgggc
atgaaccacggccccgtgatcgccggcgtgatcggcgcccagaagccgcagtacgacatc
tggggcaacaccgtcaacgtggccagcaggatggacagcaccggggtcctggacaagatt
caggtcacggaggagaccagcctcatcctgcagacgctggggtacacgtgcacgtgccgg
ggcatcatcaacgtgaagggcaagggggagctgaagacctacttcgtgagcacggaaatg
tccggctccctctcccagagcaacctggccgcctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107512248
Entry
107512248         CDS       T06036                                 

Gene name
ADCY7
Definition
(RefSeq) adenylate cyclase type 7 isoform X1
  KO
K08047  adenylate cyclase 7 [EC:4.6.1.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00230  Purine metabolism
ray01100  Metabolic pathways
ray01522  Endocrine resistance
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04072  Phospholipase D signaling pathway
ray04114  Oocyte meiosis
ray04211  Longevity regulating pathway
ray04213  Longevity regulating pathway - multiple species
ray04261  Adrenergic signaling in cardiomyocytes
ray04270  Vascular smooth muscle contraction
ray04371  Apelin signaling pathway
ray04540  Gap junction
ray04611  Platelet activation
ray04713  Circadian entrainment
ray04714  Thermogenesis
ray04723  Retrograde endocannabinoid signaling
ray04724  Glutamatergic synapse
ray04725  Cholinergic synapse
ray04727  GABAergic synapse
ray04750  Inflammatory mediator regulation of TRP channels
ray04911  Insulin secretion
ray04912  GnRH signaling pathway
ray04913  Ovarian steroidogenesis
ray04914  Progesterone-mediated oocyte maturation
ray04915  Estrogen signaling pathway
ray04916  Melanogenesis
ray04918  Thyroid hormone synthesis
ray04921  Oxytocin signaling pathway
ray04923  Regulation of lipolysis in adipocytes
ray04925  Aldosterone synthesis and secretion
ray04926  Relaxin signaling pathway
ray04927  Cortisol synthesis and secretion
ray04928  Parathyroid hormone synthesis, secretion and action
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray04970  Salivary secretion
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray04976  Bile secretion
ray05032  Morphine addiction
ray05163  Human cytomegalovirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05200  Pathways in cancer
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107512248 (ADCY7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107512248 (ADCY7)
   04371 Apelin signaling pathway
    107512248 (ADCY7)
   04020 Calcium signaling pathway
    107512248 (ADCY7)
   04072 Phospholipase D signaling pathway
    107512248 (ADCY7)
   04024 cAMP signaling pathway
    107512248 (ADCY7)
   04022 cGMP-PKG signaling pathway
    107512248 (ADCY7)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107512248 (ADCY7)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107512248 (ADCY7)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107512248 (ADCY7)
   04062 Chemokine signaling pathway
    107512248 (ADCY7)
  09152 Endocrine system
   04911 Insulin secretion
    107512248 (ADCY7)
   04923 Regulation of lipolysis in adipocytes
    107512248 (ADCY7)
   04912 GnRH signaling pathway
    107512248 (ADCY7)
   04913 Ovarian steroidogenesis
    107512248 (ADCY7)
   04915 Estrogen signaling pathway
    107512248 (ADCY7)
   04914 Progesterone-mediated oocyte maturation
    107512248 (ADCY7)
   04921 Oxytocin signaling pathway
    107512248 (ADCY7)
   04926 Relaxin signaling pathway
    107512248 (ADCY7)
   04935 Growth hormone synthesis, secretion and action
    107512248 (ADCY7)
   04918 Thyroid hormone synthesis
    107512248 (ADCY7)
   04928 Parathyroid hormone synthesis, secretion and action
    107512248 (ADCY7)
   04916 Melanogenesis
    107512248 (ADCY7)
   04925 Aldosterone synthesis and secretion
    107512248 (ADCY7)
   04927 Cortisol synthesis and secretion
    107512248 (ADCY7)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107512248 (ADCY7)
   04270 Vascular smooth muscle contraction
    107512248 (ADCY7)
  09154 Digestive system
   04970 Salivary secretion
    107512248 (ADCY7)
   04971 Gastric acid secretion
    107512248 (ADCY7)
   04972 Pancreatic secretion
    107512248 (ADCY7)
   04976 Bile secretion
    107512248 (ADCY7)
  09156 Nervous system
   04724 Glutamatergic synapse
    107512248 (ADCY7)
   04727 GABAergic synapse
    107512248 (ADCY7)
   04725 Cholinergic synapse
    107512248 (ADCY7)
   04723 Retrograde endocannabinoid signaling
    107512248 (ADCY7)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107512248 (ADCY7)
  09149 Aging
   04211 Longevity regulating pathway
    107512248 (ADCY7)
   04213 Longevity regulating pathway - multiple species
    107512248 (ADCY7)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107512248 (ADCY7)
   04714 Thermogenesis
    107512248 (ADCY7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107512248 (ADCY7)
  09165 Substance dependence
   05032 Morphine addiction
    107512248 (ADCY7)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    107512248 (ADCY7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107512248 (ADCY7)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107512248 (ADCY7)
   05163 Human cytomegalovirus infection
    107512248 (ADCY7)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107512248 (ADCY7)
Enzymes [BR:ray01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     107512248 (ADCY7)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N
Other DBs
NCBI-GeneID: 107512248
NCBI-ProteinID: XP_016003077
LinkDB
Position
Unknown
AA seq 1078 aa
MPAKGRYFLNEGEEGPGHDVLYEKYRLTSQHGPLLRTLLLVAVAACTALAAIAFGSGDPS
RHKAVLGTALVTLVVFVALYVLVYIECLVRRWLSAAALLTWACLVTLGYVLVFDSWTNAA
CAWEQLPFFLFVVFVVYTLLPFSTRGAVAAGVVSSASHLLVLGTLTGVFSKPSTRMGLQL
LANAAVFLCGNLMGAFHKHQMQDASRELFTYAVKCIQIRRKLRVEKRQQENLLLSVLPAH
ISMGMKLTIIERLKERGDRRYLPDNNFHSLYVKRHQNVSILYADIVGFTRLASDCSPKEL
VVMLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPTHARNCVKMGLDICEAIKQ
VREATGVDISMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAGVPGRVHITEAT
LSHLDKAYEVEDGHGQQRDSYLKEMNIRTYLVIDPRSQQPPPPVQHLPKPRGEATLKMRA
SVRMTRYLESWGAARPFAHLSHRESLSSGGTPVPPGRRPKAIPLRRHRTPDRSASPKGRS
EDDSYDDEMLSAIEGLSSARPCCSKSDDFYTFGSIFLEKGFEREYRLAPIPRARHYFACA
SLVFLCILLVHALLMPRTAALGVSFGLVACVLGLVLGLCFADKLLRCCPAWGTPRSISER
VETHPLLRLSLAILTVGSLLTIAIVNLPLLPSPALGPPAGNESSPSALRGGDGTPCELLQ
YYTCSCVLAFVACSVFLRMSLELKVVLLTVALVAYLVLFSVSLCSRWHCCDSPGNLTNGT
DTLSPSVCSWRDLKTMICFYLVLFYTTLIMLSRQIDYYCRLDCLWKNKFKKEHEEFETME
NVNRLLLENVLPAHVAAHFIGDKLNEDWYHQSYDCVSVMFASVPDFKVFYTECDVNKEGL
ECLRLLNEIIADFDELLLKPKFSSVEKIKTIGSTYMAAAGLSVPSGHENQDLERRHAHVG
IAVDFSAALMSKLDGINRHSFNSFRLRVGINHGPVIAGVIGARKPQYDIWGNTVNVASRM
ESTGELGKIQVTEETCTILRGLGYSCECRGLINVKGKGELRTYFVCTDAGKFQGLGLN
NT seq 3237 nt   +upstreamnt  +downstreamnt
atgccggccaagggacgctacttcctcaacgagggcgaggagggcccgggccacgacgtg
ctctacgagaagtaccgcctcaccagccagcacgggccgctgctgcgcacgctcctgctg
gtggccgtggccgcctgcaccgccctcgccgccatcgccttcggctccggggatccctcc
agacacaaggctgtgctggggacggcgctcgtgacgctcgtcgtgttcgtggccctctac
gtgctggtgtacatcgagtgcctcgtccgtcgctggctctcggccgccgcgctgctcacc
tgggcctgcctcgtgacgctgggctacgtgctggtgttcgactcatggacgaacgcggcc
tgcgcgtgggagcagctgcccttcttcctgttcgtggtcttcgtggtgtacacgctcctg
cccttcagcacgcggggggccgtggccgcgggcgtcgtctccagcgcctcccacctgctg
gtgctgggcaccctgacgggcgtcttctccaagcccagcacccggatggggctgcagctg
ctggccaacgccgccgtcttcctgtgcgggaacctcatgggcgccttccacaagcaccag
atgcaggacgcgtcccgcgagctcttcacctacgcggtcaagtgcatccagatccgcagg
aagctgcgcgtcgagaagcggcagcaggagaacctgctcctgtcggtgctgccggcccac
atctccatgggcatgaagctgaccatcatcgagcggctcaaggagcgtggggaccgccgc
tacctgcccgacaacaacttccacagcctctacgtcaagcggcaccagaatgtcagcatc
ctctacgcggacatcgtgggcttcacgcggctggccagcgactgctcccccaaagagctg
gtggtgatgctgaatgagctctttggcaagttcgaccagatcgcgaaggccaacgagtgc
atgcggatcaagatcctgggcgactgctactactgcgtgtcgggcctgcccgtgtccctg
cccacccacgcccgcaactgcgtgaagatggggctggacatctgcgaggccatcaagcag
gtgcgggaggccacgggcgtggacatcagcatgcgtgtgggcatccactccgggaacgtg
ctgtgcggtgtcatcggcctgcgcaagtggcagtacgacgtgtggtcccacgacgtgtcc
ctcgccaacaggatggaggcggctggcgtccctggccgagtgcacatcaccgaggcgacg
ctgagccacctggacaaggcgtacgaggtggaggacgggcatggccagcagcgcgactcc
tacctgaaggagatgaacatccggacgtacctggtcatcgacccccggagccagcagccg
ccgccgccggtgcagcacctccccaagcccaggggggaggcgaccctgaagatgcgggcg
tccgtgcgcatgacccgctacctcgagtcctggggcgccgctcggccctttgcccacctc
agccaccgcgagagcctgagcagcggcggaacgcccgtgccccccggccggcggcccaag
gccatccccctgcggcgccaccggacccctgacagaagcgcatccccaaaggggcggtcc
gaggatgattcgtatgacgacgagatgctgtcggccatcgagggcctcagctctgccagg
ccctgctgctccaagtctgacgacttttacacctttgggtccatcttcctggagaagggc
tttgagcgagagtaccgcctggcgcccatcccccgggcccggcactacttcgcctgcgcc
agcctcgtcttcctctgcatcctgctcgtccacgcgctgctgatgcccaggacggcggcc
ctgggggtgtcctttgggctggtggcctgtgtgctgggcttggtcctgggcctgtgcttt
gccgacaagctcctgaggtgctgccccgcctgggggacgccccggtccatctccgagagg
gtggagacgcaccccctgctgcggctgtccctggccatcctgaccgtcggcagcctgctc
accatcgccatcgtcaacctgccactgttgccttcgccagccctggggccccctgctggg
aacgagagcagcccgagcgccctccgcggtggggacgggaccccgtgcgagctcctccag
tattacacctgcagctgcgtcctggccttcgtcgcctgttctgtcttcctgcggatgagc
ctggagctgaaggtcgtgctgctgaccgtggccttggtggcctacctggtgctcttcagc
gtctccctgtgctcgcggtggcactgctgtgacagcccgggcaacctcaccaacggcacc
gacaccctcagcccctcggtctgctcgtggagggacctgaagaccatgatctgcttctac
ctggttctgttctacaccacgctcatcatgctctccaggcagatcgattactactgccgc
ctggactgtctgtggaagaacaagttcaagaaggagcacgaggagttcgagaccatggag
aacgtgaaccgcctcctcctggagaacgtcctgccggcccacgtggctgcccacttcatt
ggcgacaagttgaatgaggactggtaccatcagtcctacgactgcgtctccgtcatgttt
gcgtccgtgccggacttcaaggtcttctacacggagtgcgacgtcaacaaggagggcctg
gagtgcctgcgcctgctcaacgagatcatcgccgacttcgacgagctgctgctcaagccc
aagttcagcagcgtggagaagatcaagaccatcggcagcacctacatggcggccgccggg
ctcagcgtcccctcagggcacgagaaccaggacctggagcggcggcacgcccacgtgggc
atcgcggtggacttcagcgcggccctcatgagcaagctggacggcatcaacaggcactcc
ttcaactccttccgcctccgcgtcggcataaaccacgggcccgtgatcgcgggcgtgatc
ggggcgcggaagcctcagtacgacatctgggggaacacggtcaacgtcgccagcaggatg
gagagcactggagagctcgggaaaatccaggtgacggaggagacgtgcaccatcctccgg
ggactgggttattcctgcgagtgccgcgggctgatcaatgtcaagggcaaaggtgaactg
aggacctactttgtctgcacagacgctggcaagtttcaggggctggggctgaactga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107512406
Entry
107512406         CDS       T06036                                 

Gene name
ADCY1
Definition
(RefSeq) adenylate cyclase type 1
  KO
K08041  adenylate cyclase 1 [EC:4.6.1.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00230  Purine metabolism
ray01100  Metabolic pathways
ray01522  Endocrine resistance
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04072  Phospholipase D signaling pathway
ray04114  Oocyte meiosis
ray04211  Longevity regulating pathway
ray04213  Longevity regulating pathway - multiple species
ray04261  Adrenergic signaling in cardiomyocytes
ray04270  Vascular smooth muscle contraction
ray04371  Apelin signaling pathway
ray04540  Gap junction
ray04611  Platelet activation
ray04713  Circadian entrainment
ray04714  Thermogenesis
ray04720  Long-term potentiation
ray04723  Retrograde endocannabinoid signaling
ray04724  Glutamatergic synapse
ray04725  Cholinergic synapse
ray04727  GABAergic synapse
ray04750  Inflammatory mediator regulation of TRP channels
ray04911  Insulin secretion
ray04912  GnRH signaling pathway
ray04913  Ovarian steroidogenesis
ray04914  Progesterone-mediated oocyte maturation
ray04915  Estrogen signaling pathway
ray04916  Melanogenesis
ray04918  Thyroid hormone synthesis
ray04921  Oxytocin signaling pathway
ray04923  Regulation of lipolysis in adipocytes
ray04925  Aldosterone synthesis and secretion
ray04926  Relaxin signaling pathway
ray04927  Cortisol synthesis and secretion
ray04928  Parathyroid hormone synthesis, secretion and action
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray04970  Salivary secretion
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray04976  Bile secretion
ray05032  Morphine addiction
ray05142  Chagas disease
ray05146  Amoebiasis
ray05163  Human cytomegalovirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05200  Pathways in cancer
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107512406 (ADCY1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107512406 (ADCY1)
   04371 Apelin signaling pathway
    107512406 (ADCY1)
   04020 Calcium signaling pathway
    107512406 (ADCY1)
   04072 Phospholipase D signaling pathway
    107512406 (ADCY1)
   04024 cAMP signaling pathway
    107512406 (ADCY1)
   04022 cGMP-PKG signaling pathway
    107512406 (ADCY1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107512406 (ADCY1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107512406 (ADCY1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107512406 (ADCY1)
   04062 Chemokine signaling pathway
    107512406 (ADCY1)
  09152 Endocrine system
   04911 Insulin secretion
    107512406 (ADCY1)
   04923 Regulation of lipolysis in adipocytes
    107512406 (ADCY1)
   04912 GnRH signaling pathway
    107512406 (ADCY1)
   04913 Ovarian steroidogenesis
    107512406 (ADCY1)
   04915 Estrogen signaling pathway
    107512406 (ADCY1)
   04914 Progesterone-mediated oocyte maturation
    107512406 (ADCY1)
   04921 Oxytocin signaling pathway
    107512406 (ADCY1)
   04926 Relaxin signaling pathway
    107512406 (ADCY1)
   04935 Growth hormone synthesis, secretion and action
    107512406 (ADCY1)
   04918 Thyroid hormone synthesis
    107512406 (ADCY1)
   04928 Parathyroid hormone synthesis, secretion and action
    107512406 (ADCY1)
   04916 Melanogenesis
    107512406 (ADCY1)
   04925 Aldosterone synthesis and secretion
    107512406 (ADCY1)
   04927 Cortisol synthesis and secretion
    107512406 (ADCY1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107512406 (ADCY1)
   04270 Vascular smooth muscle contraction
    107512406 (ADCY1)
  09154 Digestive system
   04970 Salivary secretion
    107512406 (ADCY1)
   04971 Gastric acid secretion
    107512406 (ADCY1)
   04972 Pancreatic secretion
    107512406 (ADCY1)
   04976 Bile secretion
    107512406 (ADCY1)
  09156 Nervous system
   04724 Glutamatergic synapse
    107512406 (ADCY1)
   04727 GABAergic synapse
    107512406 (ADCY1)
   04725 Cholinergic synapse
    107512406 (ADCY1)
   04720 Long-term potentiation
    107512406 (ADCY1)
   04723 Retrograde endocannabinoid signaling
    107512406 (ADCY1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107512406 (ADCY1)
  09149 Aging
   04211 Longevity regulating pathway
    107512406 (ADCY1)
   04213 Longevity regulating pathway - multiple species
    107512406 (ADCY1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107512406 (ADCY1)
   04714 Thermogenesis
    107512406 (ADCY1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107512406 (ADCY1)
  09165 Substance dependence
   05032 Morphine addiction
    107512406 (ADCY1)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    107512406 (ADCY1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107512406 (ADCY1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107512406 (ADCY1)
   05163 Human cytomegalovirus infection
    107512406 (ADCY1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107512406 (ADCY1)
   05142 Chagas disease
    107512406 (ADCY1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107512406 (ADCY1)
Enzymes [BR:ray01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     107512406 (ADCY1)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 HNOBA
Other DBs
NCBI-GeneID: 107512406
NCBI-ProteinID: XP_016003382
LinkDB
Position
Unknown
AA seq 1132 aa
MAGAPAGRGGGGGGGGGGGGRRRGGPGGRERAAAPGGRRGLRACDEEFACPELEALFRGY
TLRLEQAATLKALAVLSLLAGALALAELLGAPGPAPGLARGSHPVHCALFLALLVVTNVR
SLQVPQLQHVGQLALLFSLTFALLCCPFALGGPAGLRAAAAAGPAAADQGVWQLLLVTFV
SYALLPVRSLLAVGFGLVVAASHLLVTATLVPAKRPRLWRTLGANALLFVGVNMYGVFVR
VLAERSQRRAFLQARSCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIFH
KIYIQRHDNVSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCRRIKILGD
CYYCVSGLTQPKADHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLR
KWQYDVWSNDVTLANVMEAAGLPGKVHITKTTLTCLNGDYEVEPGHGHERNSFLRTHNIE
TFFIVPSHRRKIFPGLILSDIKPAKRMRFRTVCYLLVQLMHCRRVFKAEVPFSNVMTCED
DDKRRALRTASEKLRNRSSFSTNVVHAAPGTRVNRYIGRLLEARQTDLEMADLNFFTLKY
KQAEREHKYHQLQDEHFGSAVVLALVLAALFGLVYLLVIPQSLAVLLLLVFCICFLVACV
LYLHITRVQCFPGCLTIRIRTVLCIFIVVLIYAVAQACVVGCLPWAWSASANGSLVVLSP
GGRGPVLPAAPCESAPHALLCGLVGTLPLTLFLRVSSLPKVILLSVLTASYILVLELGGY
TRAAGGGPMPGGSFEPVVAVLLFSCTLALHARQVDIKLRLDYLWAAQAEEERDDMERVKL
DNKRILFNLLPAHVAQHFLTSNPRSMDLYYQSYSQVGVMFASIPNFNDFYIELDGNNMGV
ECLRLLNEIIADFDELMEKDFYKDLEKIKTIGSTYMAAVGLVPVAGAKAKKCISAHLSTL
ADFAIEMFDVLDEINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDS
TGVPGRIQVTEEVHRLLRQGAYRFLCRGKVSVKGKGEMLTYFLEGRTDGNGPQTRPLSSE
RRTFPYGRAGLQTGLATGCPRVGAGPGALQGSGLAPRPPGPHLPPAASGKEA
NT seq 3399 nt   +upstreamnt  +downstreamnt
atggcgggggcgcccgccggccgaggcggaggcggaggcggcggcggcggcggcggcggg
cggcggcgcggcggcccgggcgggcgcgagcgggctgccgccccgggcggccggcgcggg
ctgcgggcgtgcgacgaggagttcgcgtgccccgagctggaggcgctgttccgcggctac
acgctgcggctggagcaggcggccacgctgaaggcgctggccgtgctcagcctgctggcg
ggcgcgctggcgctggccgagctgctgggcgcgccggggcccgcgccgggcctggccagg
ggctcgcaccccgtgcactgcgcgctcttcctggcgctgctcgtggtcaccaatgtccgc
tcgctgcaggtgccgcagctgcagcacgtgggccagctcgcgctgctcttcagcctcacc
ttcgcgctgctctgctgccccttcgcgctcggcggccccgccgggctccgcgccgcggcc
gccgcggggccagcggccgccgaccagggcgtctggcagctcctgctggtcaccttcgtg
tcttacgccctgctgcccgtgcgcagcctgctggccgtcggcttcgggctcgtggtggcc
gcctcgcacttgctggtcacggccaccttggtccccgccaagcgtccacgtctctggagg
acgctcggcgccaacgccctgctcttcgtgggcgtgaacatgtacggtgtcttcgtgagg
gtcctggccgagcgctcccagcggagggcctttctgcaggcccggagctgcatcgaggac
cggctgcggctggaggacgagaacgagaagcaggagcggctgctcatgagcctcctgccc
cggaatgttgccatggagatgaaggaggacttcctgaagcctccggagaggattttccac
aagatttacatccagcggcatgacaacgtgagcatcctcttcgcggacatcgtgggcttc
acgggcctggcgtcgcagtgcacggcgcaggagctggtgaagctgctgaacgagctcttc
ggcaagtttgacgagctggccacggagaaccactgccgccgcatcaagatcctgggggac
tgctactactgcgtgtccggcctcacccagcccaaggccgaccacgcgcactgctgcgtg
gagatgggcctggacatgatcgacaccatcacgtccgtggccgaggccaccgaggtggac
ctgaacatgcgcgtggggctgcacactggccgcgtcctctgcggggtcctgggcctgcgc
aagtggcagtatgacgtgtggtccaacgacgtgactttggccaacgtcatggaggccgcc
ggcctgcccggcaaggttcacatcaccaagaccacgctgacctgcctgaacggcgactac
gaggtggagccgggccacgggcacgagaggaacagctttctgaggacacacaacatcgag
accttcttcattgtgccctcacatcggcggaagatattcccagggctgatcctgtcggac
atcaagccggccaagcggatgaggttccggacggtgtgctacctgctggtgcagctcatg
cactgccggcgggtgttcaaggccgaggtccccttctccaacgtcatgacctgtgaggac
gacgacaagcgcagggcgttgaggacagcctccgagaagctcagaaaccgctcatctttc
tccacaaacgttgtgcacgccgccccaggcacccgcgtcaacaggtacatcggccgcctc
ctggaagcccgccagacggacctggagatggccgacctcaacttcttcacgctgaagtac
aagcaggccgagcgggagcacaagtaccaccagctgcaggacgagcacttcggcagcgcc
gtggtgctcgcgctcgtgctggccgccttgttcggcctcgtctacctcctggtcatcccg
cagagtctggccgtcctgctcctgctggtgttctgcatctgcttcctggtggcctgcgtc
ctgtacctgcacatcacccgggtccagtgcttcccggggtgcctgaccatccggatccgc
accgtgctgtgcattttcatcgtggtcctgatctatgccgtggcccaggcgtgcgtggtg
ggctgcctgccctgggcctggagcgccagtgccaacgggtccctggtggtcctgtcgccc
ggcggccgcggcccggtgctgccggccgcgccctgcgagtcggcgccgcacgccctgctc
tgcggcctggtgggcacgctgccgctcaccctgttcctgcgcgtctcctccttgccgaag
gtcatcctgctgtccgtgctcaccgcgtcctacatcctggtcctggagctcggcggctac
accagggccgcggggggcggccccatgcctgggggcagcttcgagccggtggtggccgtc
ctgctgttctcgtgcaccctggccctgcatgcccgccaggtggacatcaagctgcggctg
gactacctgtgggctgcgcaggctgaggaggagcgggacgacatggagcgggtcaagctg
gacaacaagaggattctgttcaacctgctgccggcccacgtggcccagcactttctcacg
tccaacccccggagcatggacctctactaccagtcgtactcgcaggtgggcgtcatgttt
gcctccatccccaacttcaatgacttctacatcgagctggatggcaacaacatgggggtg
gagtgcctgcgcctcctgaacgagatcatcgctgactttgacgagctcatggagaaggac
ttctacaaggacctggaaaagatcaagaccatcgggagcacctacatggccgcggtgggg
ctggtgcccgtggctggggccaaggctaagaagtgcatctccgcccacctcagcacgctg
gcggacttcgccatcgagatgtttgacgtcctggacgagatcaactaccagtcgtacaat
gactttgtgctccgcgtgggcatcaacgtgggccctgtggtggccggagtgatcggggct
cgccggccgcagtacgacatctggggaaacacggtcaacgtggccagtcggatggacagc
accggggttccgggcagaatccaggtgacggaggaggtgcaccggctgctgaggcagggc
gcctaccgcttcttgtgccgcggcaaggtcagcgtcaagggcaagggcgagatgctcacc
tacttcctggaaggcaggaccgatgggaacggcccccagaccaggcccctgagctcggag
cggagaacgtttccgtatgggagagccggcctccagaccggactggccacaggctgcccc
cgggtcggagccgggccgggtgcgctgcagggctcagggctcgctcctcggccccctggc
ccacacctgccgccggcagcctccggcaaggaggcttag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514224
Entry
107514224         CDS       T06036                                 

Gene name
ADCY6
Definition
(RefSeq) adenylate cyclase type 6 isoform X1
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00230  Purine metabolism
ray01100  Metabolic pathways
ray01522  Endocrine resistance
ray04015  Rap1 signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04072  Phospholipase D signaling pathway
ray04114  Oocyte meiosis
ray04211  Longevity regulating pathway
ray04213  Longevity regulating pathway - multiple species
ray04261  Adrenergic signaling in cardiomyocytes
ray04270  Vascular smooth muscle contraction
ray04371  Apelin signaling pathway
ray04540  Gap junction
ray04611  Platelet activation
ray04713  Circadian entrainment
ray04714  Thermogenesis
ray04723  Retrograde endocannabinoid signaling
ray04724  Glutamatergic synapse
ray04725  Cholinergic synapse
ray04727  GABAergic synapse
ray04742  Taste transduction
ray04750  Inflammatory mediator regulation of TRP channels
ray04911  Insulin secretion
ray04912  GnRH signaling pathway
ray04913  Ovarian steroidogenesis
ray04914  Progesterone-mediated oocyte maturation
ray04915  Estrogen signaling pathway
ray04916  Melanogenesis
ray04918  Thyroid hormone synthesis
ray04921  Oxytocin signaling pathway
ray04923  Regulation of lipolysis in adipocytes
ray04924  Renin secretion
ray04925  Aldosterone synthesis and secretion
ray04926  Relaxin signaling pathway
ray04927  Cortisol synthesis and secretion
ray04928  Parathyroid hormone synthesis, secretion and action
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray04961  Endocrine and other factor-regulated calcium reabsorption
ray04962  Vasopressin-regulated water reabsorption
ray04970  Salivary secretion
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray04976  Bile secretion
ray05032  Morphine addiction
ray05163  Human cytomegalovirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05200  Pathways in cancer
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107514224 (ADCY6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107514224 (ADCY6)
   04371 Apelin signaling pathway
    107514224 (ADCY6)
   04072 Phospholipase D signaling pathway
    107514224 (ADCY6)
   04024 cAMP signaling pathway
    107514224 (ADCY6)
   04022 cGMP-PKG signaling pathway
    107514224 (ADCY6)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107514224 (ADCY6)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107514224 (ADCY6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107514224 (ADCY6)
   04062 Chemokine signaling pathway
    107514224 (ADCY6)
  09152 Endocrine system
   04911 Insulin secretion
    107514224 (ADCY6)
   04923 Regulation of lipolysis in adipocytes
    107514224 (ADCY6)
   04912 GnRH signaling pathway
    107514224 (ADCY6)
   04913 Ovarian steroidogenesis
    107514224 (ADCY6)
   04915 Estrogen signaling pathway
    107514224 (ADCY6)
   04914 Progesterone-mediated oocyte maturation
    107514224 (ADCY6)
   04921 Oxytocin signaling pathway
    107514224 (ADCY6)
   04926 Relaxin signaling pathway
    107514224 (ADCY6)
   04935 Growth hormone synthesis, secretion and action
    107514224 (ADCY6)
   04918 Thyroid hormone synthesis
    107514224 (ADCY6)
   04928 Parathyroid hormone synthesis, secretion and action
    107514224 (ADCY6)
   04916 Melanogenesis
    107514224 (ADCY6)
   04924 Renin secretion
    107514224 (ADCY6)
   04925 Aldosterone synthesis and secretion
    107514224 (ADCY6)
   04927 Cortisol synthesis and secretion
    107514224 (ADCY6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107514224 (ADCY6)
   04270 Vascular smooth muscle contraction
    107514224 (ADCY6)
  09154 Digestive system
   04970 Salivary secretion
    107514224 (ADCY6)
   04971 Gastric acid secretion
    107514224 (ADCY6)
   04972 Pancreatic secretion
    107514224 (ADCY6)
   04976 Bile secretion
    107514224 (ADCY6)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107514224 (ADCY6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    107514224 (ADCY6)
  09156 Nervous system
   04724 Glutamatergic synapse
    107514224 (ADCY6)
   04727 GABAergic synapse
    107514224 (ADCY6)
   04725 Cholinergic synapse
    107514224 (ADCY6)
   04723 Retrograde endocannabinoid signaling
    107514224 (ADCY6)
  09157 Sensory system
   04742 Taste transduction
    107514224 (ADCY6)
   04750 Inflammatory mediator regulation of TRP channels
    107514224 (ADCY6)
  09149 Aging
   04211 Longevity regulating pathway
    107514224 (ADCY6)
   04213 Longevity regulating pathway - multiple species
    107514224 (ADCY6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107514224 (ADCY6)
   04714 Thermogenesis
    107514224 (ADCY6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107514224 (ADCY6)
  09165 Substance dependence
   05032 Morphine addiction
    107514224 (ADCY6)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    107514224 (ADCY6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107514224 (ADCY6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107514224 (ADCY6)
   05163 Human cytomegalovirus infection
    107514224 (ADCY6)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107514224 (ADCY6)
Enzymes [BR:ray01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     107514224 (ADCY6)
SSDB
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD Shisa DUF2207
Other DBs
NCBI-GeneID: 107514224
NCBI-ProteinID: XP_016007218
LinkDB
Position
Unknown
AA seq 1218 aa
MGIPSSASVSFYEDVVSEVLNSVMGSAQLVRAGGEWQPMMVVLIPSHSFPPCSMSWFSGL
LVPKVDERKTAWGECNGQKRPRHGTRTSGFCAPRYMSCLQDAQPPSPTPAAPPRCPWQEE
AFIRRGGPGKGTELGLRAVALGFEDTETTALGAADVAPNVAPRSSRSCWRRLVQVFQSKQ
FRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLTAVLLTFHAAPAHPQPAYVALLACAAVL
FVVLMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAANPHSPSVGLWCPVFFVYITY
TLLPIRMRAAVFSGLGLSTLHLILAWQLNRGDAFLWKQLGANMLLFFCTNVIGICTHYPA
EVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKKEDMMFHKI
YIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCY
YCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKW
QFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNAYLKEQHIETF
LILGASQKRKEEKAMLAKLQRTRANSMEGLMPRWVPDRAFSRSKDSKAFRQMGIDDSSKD
NRGAQDALNPEDEVDEFLGRAIDARSIDQLRKDHVRRFLLTFQREDLEKKYSRKVDPRFG
AYVACALLVFCFICFIQLLVFPHSTVMLGIYTGIFLLLLITVLTCAVYSCGSLFPKGLQH
LSRSIVRSRAHSTAVGIFSVLLVFTSAIANMFTCNHTPIRTCAARMLNLTPADITVCHLQ
QLNYSLGLDAPLCEGTAPTCSFPEYFVGNVLLSLLASSVFLHISSIGKLAMIFVLGLIYL
VLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKYMTPVILLVFALALY
LHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDEL
YYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEERFRQLEKI
KTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLMEQMKHINEHSFNNFQMKIGLNMG
PVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKGYQLECRGVVK
VKGKGEMTTYFLNGGPSS
NT seq 3657 nt   +upstreamnt  +downstreamnt
atggggatcccatcatctgcctcggtgtcattttatgaggatgttgtgtctgaagtgctg
aactcggtgatgggaagtgctcagttagtgagagctggtggcgagtggcagcccatgatg
gtggtattaataccatcccattcttttcctccttgcagcatgtcatggttcagtggcctc
ctggtacccaaagtggatgaacggaaaacagcctggggggaatgcaatgggcagaagcgc
ccgcgtcatgggactcggaccagtggcttctgcgcaccccgctatatgagctgcctccag
gatgcacagccacccagccccacccctgcagccccacctcggtgcccctggcaggaggaa
gccttcatccggaggggcggccccggcaagggcacagagctggggctgcgggccgtggcc
ctgggctttgaggacaccgagacaacagcgcttggggcagctgacgtggcacccaatgtg
gcacccaggagcagtcgatcctgttggcgccgtctggttcaggtgttccagtcgaagcag
ttccgctcagccaagctagagcgcctgtatcagcggtacttcttccagatgaaccagagc
agcttaacgctgctgatggcagtgctcgtgctgctcacggccgtgctgctgaccttccat
gccgcgcctgcccaccctcagcctgcctatgtggccctgctggcctgtgcggccgtcctc
tttgtggtgctcatggtggtgtgtaaccgacacagctttcgccaggactccatgtgggtg
gtgagctatgtggtgctgggcatcctggcagctgtgcaggttgggggtgccctggcagcc
aacccccacagcccctccgtaggcctttggtgccctgtgttctttgtctacatcacctac
actctcctacccatccgcatgcgggcagctgtcttcagtggcctgggcctctccaccctg
catttgatcttggcctggcaactcaaccgtggtgatgccttcctctggaagcagctcggt
gccaacatgctgctgttcttctgcacaaatgtcattggcatctgcacacactacccagct
gaggtgtctcagcgccaggcctttcaggagacccgcgggtacatccaggcccggctgcac
ctgcagcatgagaatcggcagcaggaacgcctgctgctgtcagtgttgccccagcacgtt
gccatggagatgaaagaagacatcaacacaaagaaggaagacatgatgttccacaagatc
tacatccagaagcatgacaatgtcagcatcctgtttgcagacattgaaggtttcaccagc
ctggcatcacagtgcactgcacaggagctggttatgaccctgaatgagctctttgcccgg
tttgacaagcttgctgcagaaaatcactgcctgaggatcaagatcttaggggactgttac
tactgtgtgtcagggttgccagaggcccgggcagaccatgcccactgctgtgtggagatg
ggagtggacatgattgaggccatctcgctggtgcgtgaggtgacaggtgtgaacgtgaac
atgcgcgtgggcatccacagtggacgtgtgcactgcggtgtccttggtctgcggaagtgg
caattcgatgtgtggtccaatgacgtgactctggccaaccacatggaggcagggggccgg
gctggccgcatccacatcactcgggccacactgcagtacctgaatggtgactacgaggtg
gagccgggccgtggtggtgagcgtaatgcgtacctcaaggagcagcacattgagaccttc
ctgatccttggtgccagccagaaacggaaagaggagaaagccatgctggccaagctgcag
cggacacgggccaactccatggaagggctgatgccacgctgggtgcctgaccgggccttc
tcccggagcaaggactccaaggcattccgccagatgggcattgatgattccagcaaagac
aaccggggtgcccaagatgctctgaaccctgaggatgaagtagatgagttcctgggccgt
gccatcgacgcccgcagcattgatcagctgcgcaaggaccatgtgcgccggttcctgctc
acttttcagagagaggatcttgaaaagaagtactcaaggaaagtggatccccgctttgga
gcctacgtggcctgtgccctgttggtcttctgcttcatctgcttcatccaactgctcgtc
ttcccacactcaacagtgatgcttgggatctacaccgggatctttctgctgctgttgatc
accgtgctgacctgcgccgtgtactcctgtggctctctgttccctaagggcctgcaacat
ctgtcacgcagcattgtgcgctctcgggcacacagcaccgccgttggcatcttttcagtc
ctgcttgtgttcacctctgccatcgctaacatgttcacctgtaaccacacccccatacgg
acctgcgcagccaggatgctgaatttaacacctgctgacatcactgtctgccacctgcag
cagctcaattactccctgggcctggatgctcccctgtgtgagggcaccgcacccacctgc
agctttcccgagtacttcgtcgggaatgtgctgctgagtctgttggccagctctgtcttc
ctacacatcagtagcatcggaaagttggccatgatctttgtcttggggctcatctatttg
gtgctgcttctcctgggccccccagccaccatctttgacaactatgacctactgcttggt
gtccatggcttggcttcttctaatgaaacttttgatgggctggactgcccagctgcaggg
agggtggcactcaaatatatgacccctgtgattctgctggtgtttgccctggccctgtat
ctgcatgctcagcaggtggaatcgactgcccgcctggacttcctctggaaactgcaggca
acaggggagaaggaggagatggaggagctccaggcgtacaaccggcggctgttgcataac
attctgcccaaggatgtagctgcccacttcctggcccgggagcgccggaatgacgagctc
tactatcagtcgtgtgagtgtgtggctgtcatgtttgcctccattgccaacttctctgag
ttctacgtggagctggaggcaaataatgagggtgtggagtgcctgcggctgctcaacgag
attatcgctgattttgatgagatcatcagtgaggagcggttccggcagctggagaagatc
aagactattggtagcacttacatggctgcctccgggctgaacgccagcacctatgaccag
gtgggccgctcccacatcactgcccttgccgactatgccatgcggctcatggagcagatg
aagcacatcaatgagcactccttcaacaatttccagatgaagattggactgaacatgggc
ccagttgtggcaggtgtcattggggctcggaagccacagtatgacatctgggggaacaca
gtgaatgtctctagccgtatggacagcacgggggtccctgacagaatccaggtgaccact
gacttgtaccaggttctggctgccaagggctatcagctggagtgtcgaggagtggtcaaa
gtgaagggcaagggggagatgaccacctacttcctgaatgggggtcccagcagttag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107518038
Entry
107518038         CDS       T06036                                 

Gene name
ADCY5
Definition
(RefSeq) LOW QUALITY PROTEIN: adenylate cyclase type 5
  KO
K08045  adenylate cyclase 5 [EC:4.6.1.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00230  Purine metabolism
ray01100  Metabolic pathways
ray01522  Endocrine resistance
ray04015  Rap1 signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04072  Phospholipase D signaling pathway
ray04114  Oocyte meiosis
ray04211  Longevity regulating pathway
ray04213  Longevity regulating pathway - multiple species
ray04261  Adrenergic signaling in cardiomyocytes
ray04270  Vascular smooth muscle contraction
ray04371  Apelin signaling pathway
ray04540  Gap junction
ray04611  Platelet activation
ray04713  Circadian entrainment
ray04714  Thermogenesis
ray04723  Retrograde endocannabinoid signaling
ray04724  Glutamatergic synapse
ray04725  Cholinergic synapse
ray04726  Serotonergic synapse
ray04727  GABAergic synapse
ray04728  Dopaminergic synapse
ray04750  Inflammatory mediator regulation of TRP channels
ray04911  Insulin secretion
ray04912  GnRH signaling pathway
ray04913  Ovarian steroidogenesis
ray04914  Progesterone-mediated oocyte maturation
ray04915  Estrogen signaling pathway
ray04916  Melanogenesis
ray04918  Thyroid hormone synthesis
ray04921  Oxytocin signaling pathway
ray04923  Regulation of lipolysis in adipocytes
ray04924  Renin secretion
ray04925  Aldosterone synthesis and secretion
ray04926  Relaxin signaling pathway
ray04927  Cortisol synthesis and secretion
ray04928  Parathyroid hormone synthesis, secretion and action
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray04970  Salivary secretion
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray04976  Bile secretion
ray05012  Parkinson disease
ray05030  Cocaine addiction
ray05031  Amphetamine addiction
ray05032  Morphine addiction
ray05034  Alcoholism
ray05163  Human cytomegalovirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05200  Pathways in cancer
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107518038 (ADCY5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107518038 (ADCY5)
   04371 Apelin signaling pathway
    107518038 (ADCY5)
   04072 Phospholipase D signaling pathway
    107518038 (ADCY5)
   04024 cAMP signaling pathway
    107518038 (ADCY5)
   04022 cGMP-PKG signaling pathway
    107518038 (ADCY5)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107518038 (ADCY5)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107518038 (ADCY5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107518038 (ADCY5)
   04062 Chemokine signaling pathway
    107518038 (ADCY5)
  09152 Endocrine system
   04911 Insulin secretion
    107518038 (ADCY5)
   04923 Regulation of lipolysis in adipocytes
    107518038 (ADCY5)
   04912 GnRH signaling pathway
    107518038 (ADCY5)
   04913 Ovarian steroidogenesis
    107518038 (ADCY5)
   04915 Estrogen signaling pathway
    107518038 (ADCY5)
   04914 Progesterone-mediated oocyte maturation
    107518038 (ADCY5)
   04921 Oxytocin signaling pathway
    107518038 (ADCY5)
   04926 Relaxin signaling pathway
    107518038 (ADCY5)
   04935 Growth hormone synthesis, secretion and action
    107518038 (ADCY5)
   04918 Thyroid hormone synthesis
    107518038 (ADCY5)
   04928 Parathyroid hormone synthesis, secretion and action
    107518038 (ADCY5)
   04916 Melanogenesis
    107518038 (ADCY5)
   04924 Renin secretion
    107518038 (ADCY5)
   04925 Aldosterone synthesis and secretion
    107518038 (ADCY5)
   04927 Cortisol synthesis and secretion
    107518038 (ADCY5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107518038 (ADCY5)
   04270 Vascular smooth muscle contraction
    107518038 (ADCY5)
  09154 Digestive system
   04970 Salivary secretion
    107518038 (ADCY5)
   04971 Gastric acid secretion
    107518038 (ADCY5)
   04972 Pancreatic secretion
    107518038 (ADCY5)
   04976 Bile secretion
    107518038 (ADCY5)
  09156 Nervous system
   04724 Glutamatergic synapse
    107518038 (ADCY5)
   04727 GABAergic synapse
    107518038 (ADCY5)
   04725 Cholinergic synapse
    107518038 (ADCY5)
   04728 Dopaminergic synapse
    107518038 (ADCY5)
   04726 Serotonergic synapse
    107518038 (ADCY5)
   04723 Retrograde endocannabinoid signaling
    107518038 (ADCY5)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107518038 (ADCY5)
  09149 Aging
   04211 Longevity regulating pathway
    107518038 (ADCY5)
   04213 Longevity regulating pathway - multiple species
    107518038 (ADCY5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107518038 (ADCY5)
   04714 Thermogenesis
    107518038 (ADCY5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107518038 (ADCY5)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107518038 (ADCY5)
  09165 Substance dependence
   05030 Cocaine addiction
    107518038 (ADCY5)
   05031 Amphetamine addiction
    107518038 (ADCY5)
   05032 Morphine addiction
    107518038 (ADCY5)
   05034 Alcoholism
    107518038 (ADCY5)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    107518038 (ADCY5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107518038 (ADCY5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107518038 (ADCY5)
   05163 Human cytomegalovirus infection
    107518038 (ADCY5)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107518038 (ADCY5)
Enzymes [BR:ray01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     107518038 (ADCY5)
SSDB
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA PEN-2 TBK1_ULD HILPDA
Other DBs
NCBI-GeneID: 107518038
NCBI-ProteinID: XP_016014846
LinkDB
Position
Unknown
AA seq 1259 aa
MSGSKSVSPPGYAAQTAAAPASRGGPEHRSAWGEADARANGYPHAPGGSARGSTKRPGGA
VTPQQQQRLASRWRSDDDDDPPLSGDDPLAGGFGFSFRSKSAWQERGGDDCGRGSRRQRR
GAAGGGSTRAPPAGGGGGSAAAAAAAGGTEVRPRSVELGLEERRGKGRXVDELEAGAVEG
DGGSADGGSLAGSGAGPGPVLSLGSCCLALLQIFRSKKFPSDKLERLYQRYFFRLNQSSL
TMLMAVLVLVCLVMLAFHAARPPLQLPYLVVLAAAVGVILVMAVLCNRAAFHQDHMGLAC
YALIAVVLVVQVVGLLLPQPRSASEGIWWTVFFIYTIYTLLPVRMRAAVLSGVLLSALHL
AIALRTNAQDQFLLKQLVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQETRECIQARLHSQ
RENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGFTSLA
SQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGM
DMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAG
RIHITKATLNYLNGDYEVEPGCGGERNAYLKEHSIETFLILRCTQKRKEEKAMIAKMNRQ
RTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNAQESANPEDEVDEFLGR
AIDARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRFGAYVACASLVFLFICFVQITI
VPHSVFMLSFYLTCFVLLTLVIFVSVIYSCVKLFPAPLQTLSKKIVRSKVNSTLVGVFTI
TLVFLAAFVNMFMCNSKDLFGCLADEHNVSTSQINACHVVESAFNYSLGDEQGFCGSPWP
NCNFPEYFTYSVLLSLLACSVFLQISCIGKLVLMLAIELIYVLVVEVPGVTLFDNADLLV
TANAIDFNNNGTSQCPEHATKVALKVVTPIVISVFVLALYLHAQQVESTARLDFLWKLQA
TEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSE
FYVELEANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDSTYDK
VGKTHIKALADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNT
VNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPPLS
NT seq 3780 nt   +upstreamnt  +downstreamnt
atgtccggctccaaaagcgtgagccccccgggctacgcggcgcagacagcggcggcgcca
gcgtcccggggaggcccggaacaccgctccgcgtggggagaggcagatgcccgcgccaat
ggctacccccacgcccccggcggttcggcccgcggctccaccaagagacccgggggggcg
gtgaccccgcagcagcagcagcgcctggccagccgctggcgcagcgacgacgacgacgac
cctccgctgagtggcgacgaccccctggccgggggctttggcttcagcttccgctctaag
tcagcctggcaggagcgcggcggcgacgactgcggacgcggcagccgccggcagcggcgg
ggcgcagctggcgggggcagcacccgggcgccccctgcgggcggcggtggcggctcggcg
gccgcggcggccgcagccggcgggaccgaggtgcgcccccgctcggtggagctgggcctg
gaggagcggcggggcaagggccgcngggtcgacgagctggaggccggcgccgtcgagggc
gacgggggctccgcggatggcggcagcttggcgggctcgggcgcgggccccggcccggtg
ctgtctctgggctcctgctgcctcgcactgctgcagatattccgctccaagaagttcccg
tcggacaagctggagcggctgtaccagcgctacttcttccgcctgaaccagagcagcctg
accatgctcatggccgtgctagtgctcgtgtgcctcgtcatgctggccttccacgcggcg
cggcccccgctccagctgccctacctggtggtgctggcggccgccgtgggcgtgatcctt
gtcatggccgtgctctgcaaccgcgccgcctttcaccaggaccacatgggcctggcctgc
tacgcgctcatcgcggtggtgctggtcgtccaggtggtgggcctgctgctgccccagcca
cgaagcgcctccgagggcatctggtggacggtgttcttcatctacaccatctacacgctg
ctacccgtgcgcatgcgggccgcagtactcagcggggtgctcctgtctgccctccacctg
gccatcgccctgcgaaccaacgcccaggaccagttcctgctcaaacagctggtctccaat
gtcctcatcttctcctgcaccaacatcgtgggtgtctgcacccactacccggcagaggtc
tcccagagacaggcgttccaggagacccgggagtgtatccaggcacggctccactcacag
cgggagaaccagcagcaggagcggctcctgctgtctgtccttccccgtcatgttgccatg
gagatgaaagcagacatcaacgccaagcaggaggatatgatgttccataagatttacatc
cagaaacatgacaatgtgagcatcctgtttgctgacatcgagggcttcaccagcttggcg
tcccagtgcacggcccaagagctggtcatgaccctcaacgagctcttcgcccgcttcgac
aagctggctgcggagaatcactgtttacgtattaagatcctgggggattgttattactgt
gtctcggggctgcctgaagcgagggccgaccacgcccactgctgcgtggagatgggcatg
gacatgattgaggccatctcgttggtccgggaggtgacaggggtgaacgtgaacatgcgc
gtgggaattcacagcgggcgagtacactgcggtgtccttggtctcaggaagtggcagttc
gacgtctggtctaacgacgtcacgctggccaaccacatggaggctggaggcaaggctgga
cgcatccacatcaccaaggccacactcaactacctgaatggagactacgaagtggagccc
ggctgtgggggcgagcgcaacgcctacctcaaggagcacagcatcgagaccttcctcatc
ctgcgctgcacccagaagcggaaagaagagaaggccatgatcgccaagatgaatcgccag
agaaccaactccatagggcacaacccgccgcactggggggctgagcgccccttctacaac
cacttgggtggcaaccaggtgtctaaggagatgaagcggatgggtttcgaagaccccaag
gacaagaatgcccaggaaagcgcgaaccccgaggacgaagtggatgaattcctgggccga
gccatcgatgccaggagtattgacaggctgcggtctgagcatgttcgcaagttcctcttg
accttcagggagcctgacttagagaagaagtactccaagcaggtggatgaccgattcggt
gcctatgtggcatgtgcctcgcttgtcttcctcttcatttgctttgtccagatcaccatc
gtgccccactccgtgttcatgttgagtttctacctgacctgtttcgtgctgctgaccttg
gtgatatttgtgtccgtcatctactcctgtgtgaagctcttccctgccccgctgcagacc
ctctccaagaagatcgtgcggtccaaggtgaacagcaccctggttggggtgttcaccatc
accctggtgttcctggcagcgtttgtcaacatgttcatgtgcaactccaaggacctgttc
ggctgcctggcagatgagcacaacgtcagcaccagccagatcaacgcttgccacgtggtg
gagtcggccttcaactacagcctgggtgacgagcagggattctgcggcagcccctggccc
aactgcaacttccctgagtacttcacctacagcgtgctgctcagcctgctggcctgctcc
gtgttcctgcagatcagctgcatcgggaagctggtgctcatgctggccatcgagctcata
tatgtgctcgtcgtcgaagtgcccggtgtcacactctttgacaatgcagacctgctagtc
accgccaacgccatagacttcaacaacaacgggacctcccagtgccctgagcacgcgacc
aaagtggcgctgaaggtggtgacgcccattgtcatctcagtctttgtgctggccctgtac
ctgcacgcccagcaggtggagtccaccgcccgcctcgacttcctctggaaactacaggcc
acggaggagaaggaggagatggaggagctgcaggcctacaaccggcggctgctgcacaac
atcctgcccaaggacgtggccgcccacttcctggcccgggagcggcgcaacgacgagctg
tactatcagtcgtgtgagtgtgtggccgtcatgttcgcctccatcgccaacttctccgag
ttctacgtggagctggaggccaacaacgagggtgtcgagtgcctgcggctgcttaatgaa
atcattgccgatttcgacgagatcatcagcgaggatcggttcaggcagctggaaaagatc
aagaccattggcagcacctacatggctgcctcaggcctcaatgattccacctatgacaag
gtgggcaagacccacatcaaggctctggccgacttcgccatgaagctgatggaccagatg
aagtacatcaacgagcactccttcaacaacttccagatgaagattgggctcaacattggc
cccgtggtggccggggtgatcggggcccgcaagcctcagtacgacatctggggcaatacg
gtgaacgtggccagccgcatggacagcaccggtgtgcctgaccgcatccaggtcaccaca
gacatgtatcaggtgctggctgccaacacataccagctggagtgccggggtgtggtcaag
gtcaagggcaaaggagagatgatgacctacttcctcaacggagggcccccgctcagttag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521680
Entry
107521680         CDS       T06036                                 

Gene name
ADCY9
Definition
(RefSeq) adenylate cyclase type 9
  KO
K08049  adenylate cyclase 9 [EC:4.6.1.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00230  Purine metabolism
ray01100  Metabolic pathways
ray01522  Endocrine resistance
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04072  Phospholipase D signaling pathway
ray04114  Oocyte meiosis
ray04211  Longevity regulating pathway
ray04213  Longevity regulating pathway - multiple species
ray04261  Adrenergic signaling in cardiomyocytes
ray04270  Vascular smooth muscle contraction
ray04371  Apelin signaling pathway
ray04540  Gap junction
ray04611  Platelet activation
ray04713  Circadian entrainment
ray04714  Thermogenesis
ray04723  Retrograde endocannabinoid signaling
ray04724  Glutamatergic synapse
ray04725  Cholinergic synapse
ray04727  GABAergic synapse
ray04750  Inflammatory mediator regulation of TRP channels
ray04911  Insulin secretion
ray04912  GnRH signaling pathway
ray04913  Ovarian steroidogenesis
ray04914  Progesterone-mediated oocyte maturation
ray04915  Estrogen signaling pathway
ray04916  Melanogenesis
ray04918  Thyroid hormone synthesis
ray04921  Oxytocin signaling pathway
ray04923  Regulation of lipolysis in adipocytes
ray04925  Aldosterone synthesis and secretion
ray04926  Relaxin signaling pathway
ray04927  Cortisol synthesis and secretion
ray04928  Parathyroid hormone synthesis, secretion and action
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray04961  Endocrine and other factor-regulated calcium reabsorption
ray04962  Vasopressin-regulated water reabsorption
ray04970  Salivary secretion
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray04976  Bile secretion
ray05032  Morphine addiction
ray05163  Human cytomegalovirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05200  Pathways in cancer
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107521680 (ADCY9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107521680 (ADCY9)
   04371 Apelin signaling pathway
    107521680 (ADCY9)
   04020 Calcium signaling pathway
    107521680 (ADCY9)
   04072 Phospholipase D signaling pathway
    107521680 (ADCY9)
   04024 cAMP signaling pathway
    107521680 (ADCY9)
   04022 cGMP-PKG signaling pathway
    107521680 (ADCY9)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107521680 (ADCY9)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107521680 (ADCY9)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107521680 (ADCY9)
   04062 Chemokine signaling pathway
    107521680 (ADCY9)
  09152 Endocrine system
   04911 Insulin secretion
    107521680 (ADCY9)
   04923 Regulation of lipolysis in adipocytes
    107521680 (ADCY9)
   04912 GnRH signaling pathway
    107521680 (ADCY9)
   04913 Ovarian steroidogenesis
    107521680 (ADCY9)
   04915 Estrogen signaling pathway
    107521680 (ADCY9)
   04914 Progesterone-mediated oocyte maturation
    107521680 (ADCY9)
   04921 Oxytocin signaling pathway
    107521680 (ADCY9)
   04926 Relaxin signaling pathway
    107521680 (ADCY9)
   04935 Growth hormone synthesis, secretion and action
    107521680 (ADCY9)
   04918 Thyroid hormone synthesis
    107521680 (ADCY9)
   04928 Parathyroid hormone synthesis, secretion and action
    107521680 (ADCY9)
   04916 Melanogenesis
    107521680 (ADCY9)
   04925 Aldosterone synthesis and secretion
    107521680 (ADCY9)
   04927 Cortisol synthesis and secretion
    107521680 (ADCY9)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107521680 (ADCY9)
   04270 Vascular smooth muscle contraction
    107521680 (ADCY9)
  09154 Digestive system
   04970 Salivary secretion
    107521680 (ADCY9)
   04971 Gastric acid secretion
    107521680 (ADCY9)
   04972 Pancreatic secretion
    107521680 (ADCY9)
   04976 Bile secretion
    107521680 (ADCY9)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107521680 (ADCY9)
   04961 Endocrine and other factor-regulated calcium reabsorption
    107521680 (ADCY9)
  09156 Nervous system
   04724 Glutamatergic synapse
    107521680 (ADCY9)
   04727 GABAergic synapse
    107521680 (ADCY9)
   04725 Cholinergic synapse
    107521680 (ADCY9)
   04723 Retrograde endocannabinoid signaling
    107521680 (ADCY9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107521680 (ADCY9)
  09149 Aging
   04211 Longevity regulating pathway
    107521680 (ADCY9)
   04213 Longevity regulating pathway - multiple species
    107521680 (ADCY9)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107521680 (ADCY9)
   04714 Thermogenesis
    107521680 (ADCY9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107521680 (ADCY9)
  09165 Substance dependence
   05032 Morphine addiction
    107521680 (ADCY9)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    107521680 (ADCY9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107521680 (ADCY9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107521680 (ADCY9)
   05163 Human cytomegalovirus infection
    107521680 (ADCY9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107521680 (ADCY9)
Enzymes [BR:ray01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     107521680 (ADCY9)
SSDB
Motif
Pfam: Guanylate_cyc DUF512 DUF1053 zf-C2HC_2 AC_N
Other DBs
NCBI-GeneID: 107521680
NCBI-ProteinID: XP_016022072
LinkDB
Position
Unknown
AA seq 1353 aa
MASPPHQQLLLHHSTEVSCDSSGDSNSVRVKINPKQLSSNSHPKHCKYSISSSCSSSGDS
GGVPRRVGAGGRLRRQKKLPQLFERASSRWWDPKFDSVNLEEACLERCFPQTQRRFRYAL
FYIGFACLLWSIYFGVHMRSKLIVMAVPALCFLVVCVGFFLFTFTKLYARHYVGTSLVLT
LLVFALTLAAQFQVLTPLSGRVDSSNHTLAAKPTDTCLSQVGSFSMCIEVLFLLYTVMHL
PLYLSLFLGVAYSVLFETFGYHFQSEDCFPSPEIGPPHWELLSRALLHVCIHAIGIHLFI
MSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDEESENSVKR
HATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLN
DLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIRAIEHFCQEK
KEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLD
DRYEMEDGRVTERLGQSVVVDQLKGLKTYLIAGQRAKESHCSCSEALLSGFEVIDGSQVS
SGPRGQGTASPGSVSDLAQTVKTFDNLKTCPSCGITFAPKSEGGTGGGAVQNGCQEEHKN
STKASGGPNSKTQNGLLSPPQEEKLTNSQTSLCEILQEKGRWAGVSLDQSALLPLRFKNI
REKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDQELEQAYRTSYQEEVMKNSPVKTF
ASATFSSLLDVFLSTTVFLILSITCFLKYWAAATPPPPAALAVFGAALLLEVLSLVVSVR
MVFFLEDVMACTKRLLEWIAGWLPRHFIGAILVSLPALAVYSHVTSEFETNIHFTVFTGS
AILIAVVHYCNFCQLSSWMRSSLATVVGAGPLLLLYISLCPDSSILESPFDAVQNFSSVR
NPCNSSLPHDSRRPASLIGQEVILVFFLLLLLVWFLNREFEVSYRLHYHGDVEADLHRTK
IQSMRDQADWLLRNIIPYHVAEQLKVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGGKE
CYRVLNELIGDFDELLSKPDYSSIEKIKTIGATYMAASGLNATQCQDGSHPQEHLQILFE
FAKEMMRVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTT
GVECRIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYLYPKCMDNGVVPQHQLSISP
DIRVQVDGSIGRSPTDEIANLVPSVQNSDKTSLGSENNTQAKDCHLSSKRPWKEPVKAEE
RCRFGKAIEKSDCEEMGMEEANELTKLNVSKSV
NT seq 4062 nt   +upstreamnt  +downstreamnt
atggcttccccgccccaccagcagctgctgctgcaccacagcaccgaggtgagttgtgac
tccagcggagacagcaacagcgtgagggtcaaaatcaaccccaagcagctatcgtccaac
agccaccccaaacactgcaagtacagcatctcttccagctgtagcagctcaggcgactca
ggcggggtcccccggagagtgggtgctggaggccgcctgcgcaggcagaagaaactgccc
caactgttcgagagggcctccagccggtggtgggaccccaaattcgactcggtgaacctg
gaggaggcttgccttgagcgctgcttcccgcagacccagcgccgcttccggtacgctctc
ttctacattggcttcgcctgcctgctctggagcatctattttggggtccacatgagatcc
aaactgatagtcatggcagtccctgctctgtgcttccttgtggtgtgtgtgggctttttc
ctgtttaccttcaccaaactgtatgcccgacattacgtggggacctcgctggttctcacc
ctcctagtgttcgccctgaccctggctgcccagtttcaggttctgacgcctctctcagga
cgtgttgacagctccaatcatactctcgcagccaagcccacagacacttgcttatctcaa
gtggggagcttttccatgtgcatcgaagtgctctttttgctttacaccgtcatgcactta
cctttgtacttgagcttgtttttgggagtggcctattctgttctttttgagacctttggc
tatcatttccaaagtgaagactgcttcccctcacctgaaatagggcctccgcactgggag
ctgttgagccgagccctgctccacgtctgtattcatgccattgggatccacctattcatc
atgtcccaggtgagatccaggagcacctttctcaaggtgggacagtccattatgcacgga
aaggatctggaagtggaaaaagccctgaaagagaggatgattcattctgtgatgccaaga
atcatagctgatgacttgatgaaacagggggacgaggagagcgagaattctgtgaaaagg
cacgccacctccagccccaagaacaggaagaaaaaatcttccatacagaaagcccctata
gcattccgcccgtttaaaatgcagcagattgaagaggtcagtattttatttgcagacatc
gtaggcttcactaagatgagtgccaacaagtccgctcatgccctggtgggtctcctcaat
gatctgttcggtcgttttgaccggttgtgtgaagagaccaagtgtgagaaaatcagcacc
ctgggagactgctactactgcgtggcagggtgccccgagccccgggctgatcatgcctac
tgctgcatcgaaatgggcttgggcatgataagagctatcgagcacttctgtcaggagaag
aaagagatggtgaacatgcgtgttggggttcacacagggactgtcttgtgcggcatcttg
ggcatgaggaggttcaaattcgatgtgtggtccaatgacgtgaacctggccaatctcatg
gagcagctgggagtggctggcaaggttcacatttctgaggccactgcaaaatacctagat
gatcggtacgaaatggaagatgggagagttactgaacgccttggccagagcgttgttgtt
gaccagttgaaaggtttgaagacatacctgatagcgggtcagagagcgaaggagtctcat
tgcagctgttcagaggccttgctttcgggctttgaggtcattgacggctcacaggtgtcc
tcaggccctaggggacaggggacagcatcgccagggagtgtcagtgacttggcacagact
gtcaaaacctttgataatcttaagacctgcccttcctgcggaatcacttttgctcccaaa
tcggaaggtggcacaggaggaggagcagtgcaaaacggctgtcaggaggagcataaaaac
agcaccaaggcttctggaggacctaattctaaaacgcaaaatggacttctgagcccaccc
caagaggagaagctcaccaatagccagacctccctgtgtgagattctacaggaaaaggga
aggtgggcaggtgtcagcttggaccagtctgctctccttccactgaggttcaagaacatc
cgggagaaaacagatgcccactttgttgatgttatcaaagaagacagcctgatgaaggat
tatttttttaagccacccattaatcagtttagcttgaacttcttggatcaggagctagag
caagcctacaggaccagttatcaagaagaggttatgaagaattctcctgtgaagactttt
gccagtgccaccttcagctccctcttggatgtgtttctgtcaacaacggtgtttctgatt
ctctccatcacctgcttcctgaagtactgggctgccgccacgcctcccccgcctgccgca
ctggcagtcttcggagcggccctgctgctggaggtgctgtccctcgtggtgtctgtcagg
atggtatttttcctggaggatgtgatggcttgtaccaagcgcctgctggagtggatagcc
ggctggctcccacgccacttcatcggggccatcctggtgtctctcccggctctcgcagtt
tattcacatgtcacctcggaatttgagacaaacatacatttcacggtgttcacgggctcg
gccatcttgatcgccgttgtgcactactgtaacttctgccagctcagctcctggatgcgg
tcctccttagctactgtcgtcggggctgggcccctccttctgctctacatttccttgtgc
ccggacagttccatactagagtcaccctttgatgcagtacagaatttcagttccgtgagg
aatccctgcaatagttcattgccacatgacagcaggagaccagccagcctgattggccag
gaggtgattcttgtcttctttctcctgctcttgttggtctggttcctgaatcgagaattc
gaagtcagctaccgccttcactaccatggggatgtggaggcggaccttcaccgcaccaaa
atccagagcatgagggatcaagctgactggctgctgaggaacatcatcccctaccatgtg
gccgaacagctgaaggtttctcagacctactccaagaaccatgacagtgggggagtcatc
tttgccagcattgtcaacttcagcgagttctacgaggaaaactacgagggaggcaaggag
tgctaccgggtcctcaacgagctgatcggggacttcgatgagctcctgagcaagccagac
tacagcagcattgagaagatcaagaccattggggccacgtacatggccgcgtcagggctg
aacgccacacagtgccaggacggcagccacccgcaggagcacctgcagattctgtttgag
tttgccaaggagatgatgcgcgtggtggacgacttcaacaacaacatgctgtggttcaac
ttcaagctcagagtcggcttcaaccacgggcccctgacagcaggggtcatcggaaccacc
aagctactgtacgacatctggggagacaccgtcaacatcgccagcaggatggacaccacg
ggggtggagtgccgcatccaggtgagtgaagagagctaccgcgtcctcagcaagatgggc
tacgactttgactacaggggcacggtgaacgtcaaaggcaaaggtcagatgaagacctac
ctttacccaaagtgcatggacaacggggtcgtgccgcagcaccagctgtccatctcccca
gacatccgagtccaggtggacggcagcatcggacggtcccccacggacgagattgccaac
ctggtgccttccgtacagaactcggacaagacgtctctgggttctgagaacaacacacag
gccaaggactgtcacctgtcttcaaagagaccctggaaggagcctgtcaaagccgaagaa
aggtgtcgattcggcaaagccatagagaaaagcgactgtgaagaaatggggatggaagaa
gccaatgaactcaccaagctcaatgtctcaaagagtgtgtga

DBGET integrated database retrieval system