KEGG   Homo sapiens (human): 102
Entry
102               CDS       T01001                                 
Symbol
ADAM10, AD10, AD18, CD156c, CDw156, HsT18717, MADM, RAK, kuz
Name
(RefSeq) ADAM metallopeptidase domain 10
  KO
K06704  disintegrin and metalloproteinase domain-containing protein 10 [EC:3.4.24.81]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05010  Alzheimer disease
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
Disease
H00056  Alzheimer disease
Drug target
Aderbasib: D09320
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    102 (ADAM10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102 (ADAM10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    102 (ADAM10)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    102 (ADAM10)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.81  ADAM10 endopeptidase
     102 (ADAM10)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   102 (ADAM10)
CD molecules [BR:hsa04090]
 Proteins
  102 (ADAM10)
SSDB
Motif
Pfam: Reprolysin_2 Reprolysin_5 Reprolysin_3 Reprolysin_4 Disintegrin Pep_M12B_propep Reprolysin Peptidase_M66
Other DBs
NCBI-GeneID: 102
NCBI-ProteinID: NP_001101
OMIM: 602192
HGNC: 188
Ensembl: ENSG00000137845
Pharos: O14672(Tchem)
UniProt: O14672 A0A024R5U5
Structure
LinkDB
Position
15:complement(58588809..58749707)
AA seq 748 aa
MVLLRVLILLLSWAAGMGGQYGNPLNKYIRHYEGLSYNVDSLHQKHQRAKRAVSHEDQFL
RLDFHAHGRHFNLRMKRDTSLFSDEFKVETSNKVLDYDTSHIYTGHIYGEEGSFSHGSVI
DGRFEGFIQTRGGTFYVEPAERYIKDRTLPFHSVIYHEDDINYPHKYGPQGGCADHSVFE
RMRKYQMTGVEEVTQIPQEEHAANGPELLRKKRTTSAEKNTCQLYIQTDHLFFKYYGTRE
AVIAQISSHVKAIDTIYQTTDFSGIRNISFMVKRIRINTTADEKDPTNPFRFPNIGVEKF
LELNSEQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSSGGICEKSKLYSDGKKKSLNT
GIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYAR
ATSGDKLNNNKFSLCSIRNISQVLEKKRNNCFVESGQPICGNGMVEQGEECDCGYSDQCK
DECCFDANQPEGRKCKLKPGKQCSPSQGPCCTAQCAFKSKSEKCRDDSDCAREGICNGFT
ALCPASDPKPNFTDCNRHTQVCINGQCAGSICEKYGLEECTCASSDGKDDKELCHVCCMK
KMDPSTCASTGSVQWSRHFSGRTITLQPGSPCNDFRGYCDVFMRCRLVDADGPLARLKKA
IFSPELYENIAEWIVAHWWAVLLMGIALIMLMAGFIKICSVHTPSSNPKLPPPKPLPGTL
KRRRPPQPIQQPQRQRPRESYQMGHMRR
NT seq 2247 nt   +upstreamnt  +downstreamnt
atggtgttgctgagagtgttaattctgctcctctcctgggcggcggggatgggaggtcag
tatgggaatcctttaaataaatatatcagacattatgaaggattatcttacaatgtggat
tcattacaccaaaaacaccagcgtgccaaaagagcagtctcacatgaagaccaattttta
cgtctagatttccatgcccatggaagacatttcaacctacgaatgaagagggacacttcc
cttttcagtgatgaatttaaagtagaaacatcaaataaagtacttgattatgatacctct
catatttacactggacatatttatggtgaagaaggaagttttagccatgggtctgttatt
gatggaagatttgaaggattcatccagactcgtggtggcacattttatgttgagccagca
gagagatatattaaagaccgaactctgccatttcactctgtcatttatcatgaagatgat
attaactatccccataaatacggtcctcaggggggctgtgcagatcattcagtatttgaa
agaatgaggaaataccagatgactggtgtagaggaagtaacacagatacctcaagaagaa
catgctgctaatggtccagaacttctgaggaaaaaacgtacaacttcagctgaaaaaaat
acttgtcagctttatattcagactgatcatttgttctttaaatattacggaacacgagaa
gctgtgattgcccagatatccagtcatgttaaagcgattgatacaatttaccagaccaca
gacttctccggaatccgtaacatcagtttcatggtgaaacgcataagaatcaatacaact
gctgatgagaaggaccctacaaatcctttccgtttcccaaatattggtgtggagaagttt
ctggaattgaattctgagcagaatcatgatgactactgtttggcctatgtcttcacagac
cgagattttgatgatggcgtacttggtctggcttgggttggagcaccttcaggaagctct
ggaggaatatgtgaaaaaagtaaactctattcagatggtaagaagaagtccttaaacact
ggaattattactgttcagaactatgggtctcatgtacctcccaaagtctctcacattact
tttgctcacgaagttggacataactttggatccccacatgattctggaacagagtgcaca
ccaggagaatctaagaatttgggtcaaaaagaaaatggcaattacatcatgtatgcaaga
gcaacatctggggacaaacttaacaacaataaattctcactctgtagtattagaaatata
agccaagttcttgagaagaagagaaacaactgttttgttgaatctggccaacctatttgt
ggaaatggaatggtagaacaaggtgaagaatgtgattgtggctatagtgaccagtgtaaa
gatgaatgctgcttcgatgcaaatcaaccagagggaagaaaatgcaaactgaaacctggg
aaacagtgcagtccaagtcaaggtccttgttgtacagcacagtgtgcattcaagtcaaag
tctgagaagtgtcgggatgattcagactgtgcaagggaaggaatatgtaatggcttcaca
gctctctgcccagcatctgaccctaaaccaaacttcacagactgtaataggcatacacaa
gtgtgcattaatgggcaatgtgcaggttctatctgtgagaaatatggcttagaggagtgt
acgtgtgccagttctgatggcaaagatgataaagaattatgccatgtatgctgtatgaag
aaaatggacccatcaacttgtgccagtacagggtctgtgcagtggagtaggcacttcagt
ggtcgaaccatcaccctgcaacctggatccccttgcaacgattttagaggttactgtgat
gttttcatgcggtgcagattagtagatgctgatggtcctctagctaggcttaaaaaagca
atttttagtccagagctctatgaaaacattgctgaatggattgtggctcattggtgggca
gtattacttatgggaattgctctgatcatgctaatggctggatttattaagatatgcagt
gttcatactccaagtagtaatccaaagttgcctcctcctaaaccacttccaggcacttta
aagaggaggagacctccacagcccattcagcaaccccagcgtcagcggccccgagagagt
tatcaaatgggacacatgagacgctaa

KEGG   Homo sapiens (human): 6868
Entry
6868              CDS       T01001                                 
Symbol
ADAM17, ADAM18, CD156B, CSVP, NISBD, NISBD1, TACE
Name
(RefSeq) ADAM metallopeptidase domain 17
  KO
K06059  disintegrin and metalloproteinase domain-containing protein 17 [EC:3.4.24.86]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04330  Notch signaling pathway
hsa05010  Alzheimer disease
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05171  Coronavirus disease - COVID-19
Disease
H02467  Neonatal inflammatory skin and bowel disease
Drug target
Aderbasib: D09320
Apratastat: D08859
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    6868 (ADAM17)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    6868 (ADAM17)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    6868 (ADAM17)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    6868 (ADAM17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    6868 (ADAM17)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    6868 (ADAM17)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.86  ADAM 17 endopeptidase
     6868 (ADAM17)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   6868 (ADAM17)
CD molecules [BR:hsa04090]
 Proteins
  6868 (ADAM17)
SSDB
Motif
Pfam: Reprolysin_5 Reprolysin_2 ADAM17_MPD Disintegrin Reprolysin_3 Reprolysin Pep_M12B_propep Reprolysin_4
Other DBs
NCBI-GeneID: 6868
NCBI-ProteinID: NP_003174
OMIM: 603639
HGNC: 195
Ensembl: ENSG00000151694
Pharos: P78536(Tchem)
UniProt: P78536 B2RNB2
Structure
LinkDB
Position
2:complement(9488486..9555830)
AA seq 824 aa
MRQSLLFLTSVVPFVLAPRPPDDPGFGPHQRLEKLDSLLSDYDILSLSNIQQHSVRKRDL
QTSTHVETLLTFSALKRHFKLYLTSSTERFSQNFKVVVVDGKNESEYTVKWQDFFTGHVV
GEPDSRVLAHIRDDDVIIRINTDGAEYNIEPLWRFVNDTKDKRMLVYKSEDIKNVSRLQS
PKVCGYLKVDNEELLPKGLVDREPPEELVHRVKRRADPDPMKNTCKLLVVADHRFYRYMG
RGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGIQIEQIRILKSPQEVKPGEKHYNM
AKSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANS
HGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGL
AECAPNEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESKAQECFQERSNKVCGN
SRVDEGEECDPGIMYLNNDTCCNSDCTLKEGVQCSDRNSPCCKNCQFETAQKKCQEAINA
TCKGVSYCTGNSSECPPPGNAEDDTVCLDLGKCKDGKCIPFCEREQQLESCACNETDNSC
KVCCRDLSGRCVPYVDAEQKNLFLRKGKPCTVGFCDMNGKCEKRVQDVIERFWDFIDQLS
INTFGKFLADNIVGSVLVFSLIFWIPFSILVHCVDKKLDKQYESLSLFHPSNVEMLSSMD
SASVRIIKPFPAPQTPGRLQPAPVIPSAPAAPKLDHQRMDTIQEDPSTDSHMDEDGFEKD
PFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQNRVDSKETEC
NT seq 2475 nt   +upstreamnt  +downstreamnt
atgaggcagtctctcctattcctgaccagcgtggttcctttcgtgctggcgccgcgacct
ccggatgacccgggcttcggcccccaccagagactcgagaagcttgattctttgctctca
gactacgatattctctctttatctaatatccagcagcattcggtaagaaaaagagatcta
cagacttcaacacatgtagaaacactactaactttttcagctttgaaaaggcattttaaa
ttatacctgacatcaagtactgaacgtttttcacaaaatttcaaggtcgtggtggtggat
ggtaaaaacgaaagcgagtacactgtaaaatggcaggacttcttcactggacacgtggtt
ggtgagcctgactctagggttctagcccacataagagatgatgatgttataatcagaatc
aacacagatggggccgaatataacatagagccactttggagatttgttaatgataccaaa
gacaaaagaatgttagtttataaatctgaagatatcaagaatgtttcacgtttgcagtct
ccaaaagtgtgtggttatttaaaagtggataatgaagagttgctcccaaaagggttagta
gacagagaaccacctgaagagcttgttcatcgagtgaaaagaagagctgacccagatccc
atgaagaacacgtgtaaattattggtggtagcagatcatcgcttctacagatacatgggc
agaggggaagagagtacaactacaaattacttaatagagctaattgacagagttgatgac
atctatcggaacacttcatgggataatgcaggttttaaaggctatggaatacagatagag
cagattcgcattctcaagtctccacaagaggtaaaacctggtgaaaagcactacaacatg
gcaaaaagttacccaaatgaagaaaaggatgcttgggatgtgaagatgttgctagagcaa
tttagctttgatatagctgaggaagcatctaaagtttgcttggcacaccttttcacatac
caagattttgatatgggaactcttggattagcttatgttggctctcccagagcaaacagc
catggaggtgtttgtccaaaggcttattatagcccagttgggaagaaaaatatctatttg
aatagtggtttgacgagcacaaagaattatggtaaaaccatccttacaaaggaagctgac
ctggttacaactcatgaattgggacataattttggagcagaacatgatccggatggtcta
gcagaatgtgccccgaatgaggaccagggagggaaatatgtcatgtatcccatagctgtg
agtggcgatcacgagaacaataagatgttttcaaactgcagtaaacaatcaatctataag
accattgaaagtaaggcccaggagtgttttcaagaacgcagcaataaagtttgtgggaac
tcgagggtggatgaaggagaagagtgtgatcctggcatcatgtatctgaacaacgacacc
tgctgcaacagcgactgcacgttgaaggaaggtgtccagtgcagtgacaggaacagtcct
tgctgtaaaaactgtcagtttgagactgcccagaagaagtgccaggaggcgattaatgct
acttgcaaaggcgtgtcctactgcacaggtaatagcagtgagtgcccgcctccaggaaat
gctgaagatgacactgtttgcttggatcttggcaagtgtaaggatgggaaatgcatccct
ttctgcgagagggaacagcagctggagtcctgtgcatgtaatgaaactgacaactcctgc
aaggtgtgctgcagggacctttctggccgctgtgtgccctatgtcgatgctgaacaaaag
aacttatttttgaggaaaggaaagccctgtacagtaggattttgtgacatgaatggcaaa
tgtgagaaacgagtacaggatgtaattgaacgattttgggatttcattgaccagctgagc
atcaatacttttggaaagtttttagcagacaacatcgttgggtctgtcctggttttctcc
ttgatattttggattcctttcagcattcttgtccattgtgtggataagaaattggataaa
cagtatgaatctctgtctctgtttcaccccagtaacgtcgaaatgctgagcagcatggat
tctgcatcggttcgcattatcaaaccctttcctgcgccccagactccaggccgcctgcag
cctgcccctgtgatcccttcggcgccagcagctccaaaactggaccaccagagaatggac
accatccaggaagaccccagcacagactcacatatggacgaggatgggtttgagaaggac
cccttcccaaatagcagcacagctgccaagtcatttgaggatctcacggaccatccggtc
accagaagtgaaaaggctgcctcctttaaactgcagcgtcagaatcgtgttgacagcaaa
gaaacagagtgctaa

DBGET integrated database retrieval system