KEGG   Homo sapiens (human): 1109
Entry
1109              CDS       T01001                                 
Symbol
AKR1C4, 3-alpha-HSD, C11, CDR, CHDR, DD-4, DD4, HAKRA
Name
(RefSeq) aldo-keto reductase family 1 member C4
  KO
K00037  3alpha-hydroxysteroid 3-dehydrogenase / chlordecone reductase [EC:1.1.1.50 1.1.1.357 1.1.1.225]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00120  Primary bile acid biosynthesis
hsa00140  Steroid hormone biosynthesis
hsa01100  Metabolic pathways
hsa05208  Chemical carcinogenesis - reactive oxygen species
Module
hsa_M00104  Bile acid biosynthesis, cholesterol => cholate/chenodeoxycholate
Network
nt06022  Bile acid biosynthesis
nt06226  KEAP1-NRF2 signaling
nt06251  CYP-mediated ROS formation
  Element
N00805  Bile acid biosynthesis
N01401  Benzo[a]pyrenre to CYP-mediated metabolism
N01413  Metals to KEAP1-NRF2 signalig pathway
Disease
H00607  46,XY gonadal dysgenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    1109 (AKR1C4)
   00140 Steroid hormone biosynthesis
    1109 (AKR1C4)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    1109 (AKR1C4)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.50  3alpha-hydroxysteroid 3-dehydrogenase (Si-specific)
     1109 (AKR1C4)
    1.1.1.225  chlordecone reductase
     1109 (AKR1C4)
    1.1.1.357  3alpha-hydroxysteroid 3-dehydrogenase
     1109 (AKR1C4)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 1109
NCBI-ProteinID: NP_001809
OMIM: 600451
HGNC: 387
Ensembl: ENSG00000198610
Pharos: P17516(Tbio)
UniProt: P17516
Structure
LinkDB
Position
10:5196837..5218949
AA seq 323 aa
MDPKYQRVELNDGHFMPVLGFGTYAPPEVPRNRAVEVTKLAIEAGFRHIDSAYLYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWCTFFQPQMVQPALESSLKKLQLDYVDLYLLHFPM
ALKPGETPLPKDENGKVIFDTVDLSATWEVMEKCKDAGLAKSIGVSNFNCRQLEMILNKP
GLKYKPVCNQVECHPYLNQSKLLDFCKSKDIVLVAHSALGTQRHKLWVDPNSPVLLEDPV
LCALAKKHKQTPALIALRYQLQRGVVVLAKSYNEQRIRENIQVFEFQLTSEDMKVLDGLN
RNYRYVVMDFLMDHPDYPFSDEY
NT seq 972 nt   +upstreamnt  +downstreamnt
atggatcccaaatatcagcgtgtagagctaaatgatggtcacttcatgcccgtattggga
tttggcacctatgcacctccagaggttccgaggaacagagctgtagaggtcaccaaatta
gcaatagaagctggcttccgccatattgattctgcttatttatacaataatgaggagcag
gttggactggccatccgaagcaagattgcagatggcagtgtgaagagagaagacatattc
tacacttcaaagctttggtgcactttctttcaaccacagatggtccaaccagccttggaa
agctcactgaaaaaacttcaactggactatgttgacctctatcttcttcatttcccaatg
gctctcaagccaggtgagacgccactaccaaaagatgaaaatggaaaagtaatattcgac
acagtggatctctctgccacatgggaggtcatggagaagtgtaaggatgcaggattggcc
aagtccatcggggtgtcaaacttcaactgcaggcagctggagatgatcctcaacaagcca
ggactcaagtacaagcctgtctgcaaccaggtagaatgtcatccttacctcaaccagagc
aaactgctggatttctgcaagtcaaaagacattgttctggttgcccacagtgctctggga
acccaacgacataaactatgggtggacccaaactccccagttcttttggaggacccagtt
ctttgtgccttagcaaagaaacacaaacaaaccccagccctgattgccctgcgctaccag
ctgcagcgtggggttgtggtcctggccaagagctacaatgagcagcggatcagagagaac
atccaggtttttgaattccagttgacatcagaggatatgaaagttctagatggtctaaac
agaaattatcgatatgttgtcatggattttcttatggaccatcctgattatccattttca
gatgaatattag

DBGET integrated database retrieval system