KEGG   Homo sapiens (human): 11186
Entry
11186             CDS       T01001                                 
Symbol
RASSF1, 123F2, NORE2A, RASSF1A, RDA32, REH3P21
Name
(RefSeq) Ras association domain family member 1
  KO
K09850  Ras association domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04390  Hippo signaling pathway
hsa04392  Hippo signaling pathway - multiple species
hsa05200  Pathways in cancer
hsa05206  MicroRNAs in cancer
hsa05219  Bladder cancer
hsa05223  Non-small cell lung cancer
Network
nt06213  Other RAS signaling
nt06266  Non-small cell lung cancer
  Element
N00096  EGF-EGFR-RAS-RASSF1 signaling pathway
N00097  Loss of RASSF1 to RAS-RASSF1 signaling pathway
Disease
H00014  Non-small cell lung cancer
H00022  Bladder cancer
H00054  Nasopharyngeal cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    11186 (RASSF1)
   04390 Hippo signaling pathway
    11186 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    11186 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    11186 (RASSF1)
   05206 MicroRNAs in cancer
    11186 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    11186 (RASSF1)
   05223 Non-small cell lung cancer
    11186 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Mst1_SARAH
Other DBs
NCBI-GeneID: 11186
NCBI-ProteinID: NP_733832
OMIM: 605082
HGNC: 9882
Ensembl: ENSG00000068028
Pharos: Q9NS23(Tbio)
UniProt: Q9NS23
LinkDB
Position
3:complement(50329788..50340836)
AA seq 344 aa
MSGEPELIELRELAPAGRAGKGRTRLERANALRIARGTACNPTRQLVPGRGHRFQPAGPA
THTWCDLCGDFIWGVVRKGLQCARLSADCKFTCHYRCRALVCLDCCGPRDLGWEPAVERD
TNVDEPVEWETPDLSQAEIEQKIKEYNAQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSV
PSSKKPPSLQDARRGPGRGTSVRRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVV
DDPRKFALFERAERHGQVYLRKLLDDEQPLRLRLLAGPSDKALSFVLKENDSGEVNWDAF
SMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgtcgggggagcctgagctcattgagctgcgggagctggcacccgctgggcgcgctggg
aagggccgcacccggctggagcgtgccaacgcgctgcgcatcgcgcggggcaccgcgtgc
aaccccacacggcagctggtccctggccgtggccaccgcttccagcccgcggggcccgcc
acgcacacgtggtgcgacctctgtggcgacttcatctggggcgtcgtgcgcaaaggcctg
cagtgcgcgcgcctctctgcagattgcaagttcacctgccactaccgctgccgcgcgctc
gtctgcctggactgttgcgggccccgggacctgggctgggaacccgcggtggagcgggac
acgaacgtggacgagcctgtggagtgggagacacctgacctttctcaagctgagattgag
cagaagatcaaggagtacaatgcccagatcaacagcaacctcttcatgagcttgaacaag
gacggttcttacacaggcttcatcaaggttcagctgaagctggtgcgccctgtctctgtg
ccctccagcaagaagccaccctccttgcaggatgcccggcggggcccaggacggggcaca
agtgtcaggcgccgcacttccttttacctgcccaaggatgctgtcaagcacctgcatgtg
ctgtcacgcacaagggcacgtgaagtcattgaggccctgctgcgaaagttcttggtggtg
gatgacccccgcaagtttgcactctttgagcgcgctgagcgtcacggccaagtgtacttg
cggaagctgttggatgatgagcagcccctgcggctgcggctcctggcagggcccagtgac
aaggccctgagctttgtcctgaaggaaaatgactctggggaggtgaactgggacgccttc
agcatgcctgaactacataacttcctacgtatcctgcagcgggaggaggaggagcacctc
cgccagatcctgcagaagtactcctattgccgccagaagatccaagaggccctgcacgcc
tgcccccttgggtga

KEGG   Homo sapiens (human): 83593
Entry
83593             CDS       T01001                                 
Symbol
RASSF5, Maxp1, NORE1, NORE1A, NORE1B, RAPL, RASSF3
Name
(RefSeq) Ras association domain family member 5
  KO
K08015  Ras association domain-containing protein 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04218  Cellular senescence
hsa04670  Leukocyte transendothelial migration
hsa05200  Pathways in cancer
hsa05223  Non-small cell lung cancer
Network
nt06213  Other RAS signaling
nt06266  Non-small cell lung cancer
  Element
N00096  EGF-EGFR-RAS-RASSF1 signaling pathway
N00097  Loss of RASSF1 to RAS-RASSF1 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    83593 (RASSF5)
   04015 Rap1 signaling pathway
    83593 (RASSF5)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    83593 (RASSF5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    83593 (RASSF5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    83593 (RASSF5)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    83593 (RASSF5)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 C1_2
Other DBs
NCBI-GeneID: 83593
NCBI-ProteinID: NP_872604
OMIM: 607020
HGNC: 17609
Ensembl: ENSG00000266094
Pharos: Q8WWW0(Tbio)
UniProt: Q8WWW0 A8K5F3
Structure
LinkDB
Position
1:206507531..206589448
AA seq 418 aa
MAMASPAIGQRPYPLLLDPEPPRYLQSLSGPELPPPPPDRSSRLCVPAPLSTAPGAREGR
SARRAARGNLEPPPRASRPARPLRPGLQQRLRRRPGAPRPRDVRSIFEQPQDPRVPAERG
EGHCFAELVLPGGPGWCDLCGREVLRQALRCTNCKFTCHPECRSLIQLDCSQQEGLSRDR
PSPESTLTVTFSQNVCKPVEETQRPPTLQEIKQKIDSYNTREKNCLGMKLSEDGTYTGFI
KVHLKLRRPVTVPAGIRPQSIYDAIKEVNLAATTDKRTSFYLPLDAIKQLHISSTTTVSE
VIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADRPLYLRLLAGPDTEVLSFVLK
ENETGEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRESQGKPG
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggccatggcgtccccggccatcgggcagcgcccgtacccgctactattggaccccgag
ccgccgcgctatctacagagcctgagcggccccgagctaccgccgccgccccccgaccgg
tcctcgcgcctctgtgtcccggcgcccctctccactgcgcccggggcgcgcgaggggcgc
agcgcccggagggctgcccgggggaacctggagcccccgccccgggcctcccgacccgct
cgcccgctccggcctggtctgcagcagagactgcggcggcggcctggagcgccccgaccc
cgcgacgtgcggagcatcttcgagcagccgcaggatcccagagtcccggcggagcgaggc
gaggggcactgcttcgccgagttggtgctgccgggcggccccggctggtgtgacctgtgc
ggacgagaggtgctgcggcaggcgctgcgctgcactaactgtaaattcacctgtcaccca
gaatgccgcagcctgatccagttggactgcagtcagcaggagggtttatcccgggacaga
ccctctccagaaagcaccctcaccgtgaccttcagccagaatgtctgtaaacctgtggag
gagacacagcgcccgcccacactgcaggagatcaagcagaagatcgacagctacaacacg
cgagagaagaactgcctgggcatgaaactgagtgaagacggcacctacacgggtttcatc
aaagtgcatctgaaactccggcggcctgtgacggtgcctgctgggatccggccccagtcc
atctatgatgccatcaaggaggtgaacctggcggctaccacggacaagcggacatccttc
tacctgcccctagatgccatcaagcagctgcacatcagcagcaccaccaccgtcagtgag
gtcatccaggggctgctcaagaagttcatggttgtggacaatccccagaagtttgcactt
tttaagcggatacacaaggacggacaagtgctcttccagaaactctccattgctgaccgc
cccctctacctgcgcctgcttgctgggcctgacacggaggtcctcagctttgtgctaaag
gagaatgaaactggagaggtagagtgggatgccttctccatccctgaacttcagaacttc
ctaacaatcctggaaaaagaggagcaggacaaaatccaacaagtgcaaaagaagtatgac
aagtttaggcagaaactggaggaggccttaagagaatcccagggcaaacctgggtaa

DBGET integrated database retrieval system