KEGG   Homo sapiens (human): 1140
Entry
1140              CDS       T01001                                 

Symbol
CHRNB1, ACHRB, CHRNB, CMS1D, CMS2A, CMS2C, SCCMS
Name
(RefSeq) cholinergic receptor nicotinic beta 1 subunit
  KO
K04812  nicotinic acetylcholine receptor beta-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Disease
H00770  Congenital myasthenic syndrome
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Cytisine: D07770
Gantacurium chloride: D04303
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611<US>
Metocurine iodide: D00761
Nicotine (DG00994): D03365<JP/US> D05156 D05157
Suxamethonium (DG00768): D00766<US> D02275<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1140 (CHRNB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1140 (CHRNB1)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1140 (CHRNB1)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD
Other DBs
NCBI-GeneID: 1140
NCBI-ProteinID: NP_000738
OMIM: 100710
HGNC: 1961
Ensembl: ENSG00000170175
Vega: OTTHUMG00000108139
Pharos: P11230(Tclin)
UniProt: P11230
LinkDB
Position
17p13.1
AA seq 501 aa
MTPGALLMLLGALGAPLAPGVRGSEAEGRLREKLFSGYDSSVRPAREVGDRVRVSVGLIL
AQLISLNEKDEEMSTKVYLDLEWTDYRLSWDPAEHDGIDSLRITAESVWLPDVVLLNNND
GNFDVALDISVVVSSDGSVRWQPPGIYRSSCSIQVTYFPFDWQNCTMVFSSYSYDSSEVS
LQTGLGPDGQGHQEIHIHEGTFIENGQWEIIHKPSRLIQPPGDPRGGREGQRQEVIFYLI
IRRKPLFYLVNVIAPCILITLLAIFVFYLPPDAGEKMGLSIFALLTLTVFLLLLADKVPE
TSLSVPIIIKYLMFTMVLVTFSVILSVVVLNLHHRSPHTHQMPLWVRQIFIHKLPLYLRL
KRPKPERDLMPEPPHCSSPGSGWGRGTDEYFIRKPPSDFLFPKPNRFQPELSAPDLRRFI
DGPNRAVALLPELREVVSSISYIARQLQEQEDHDALKEDWQFVAMVVDRLFLWTFIIFTS
VGTLVIFLDATYHLPPPDPFP
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgaccccaggggctctgctgatgctgctgggggcgctgggggcgccgctcgccccaggc
gtccgcggctcggaggcggagggtcgactccgggagaaacttttctctggctatgatagc
tccgtgcggccagcgcgggaggtgggagaccgtgtcagggtcagcgttggtctcatcctg
gcgcaactcatcagcctgaacgagaaggatgaagagatgagcacaaaggtgtacttagac
ctggagtggactgactacaggctgagctgggaccctgcggagcacgacggcatcgattcg
ctccgcatcacggcggaatccgtgtggctccctgacgtggtgctactgaacaacaatgat
gggaattttgacgtggctctggacattagcgtcgtggtgtcctccgacggctccgtgcgt
tggcaacccccgggcatctatcgcagcagctgcagcatccaggtcacctacttccccttc
gactggcagaattgcactatggtgttcagctcctacagctacgacagctcggaggtcagc
ctgcagacaggcctgggtcctgacgggcaagggcatcaggaaatccacattcatgaaggg
actttcattgagaatggccagtgggagattatccacaagccctctcggctaatccagcct
ccaggcgatcctaggggagggagggaaggacagcgccaggaagtcatcttctacctcatc
atccgccgcaagcctctcttctacctggtcaacgtcattgccccatgcatcctcatcact
cttctggccatcttcgtcttctacctgccaccagatgcaggagagaagatggggctctca
atctttgccctgctgacccttactgtgttcctgctgctgctggctgacaaagtacctgag
acctcactatcagtacccattattatcaagtacctcatgtttaccatggtcctcgtcacc
ttctcagtcatccttagtgtcgtggttctcaacctgcaccaccgctcaccccacacccac
caaatgcccctttgggtccgtcagatcttcattcacaaacttccgctgtacctgcgtcta
aaaaggcccaaacccgagagagacctgatgccggagccccctcactgttcttctccagga
agtggctggggtcggggaacagatgaatatttcatccggaagccgccaagtgattttctc
ttccccaaacccaataggttccagcctgaactgtctgcccctgatctgcggcgatttatc
gatggtccaaaccgggctgtggccctgcttccggagctacgggaggtcgtctcctctatc
agctacatcgctcgacagctgcaggaacaggaggaccacgatgcgctgaaggaggactgg
cagtttgtggccatggtagtggaccgcctcttcctgtggactttcatcatcttcaccagc
gttgggaccctagtcatcttcctggacgccacgtaccacttgccccctccagaccccttt
ccttga

DBGET integrated database retrieval system