KEGG   Homo sapiens (human): 1146
Entry
1146              CDS       T01001                                 

Symbol
CHRNG, ACHRG
Name
(RefSeq) cholinergic receptor nicotinic gamma subunit
  KO
K04818  nicotinic acetylcholine receptor gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Disease
H00986  Multiple pterygium syndrome
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Cytisine: D07770
Gantacurium chloride: D04303
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611<US>
Metocurine iodide: D00761
Nicotine (DG00994): D03365<JP/US> D05156 D05157
Suxamethonium (DG00768): D00766<US> D02275<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1146 (CHRNG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1146 (CHRNG)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1146 (CHRNG)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 1146
NCBI-ProteinID: NP_005190
OMIM: 100730
HGNC: 1967
Ensembl: ENSG00000196811
Vega: OTTHUMG00000153327
Pharos: P07510(Tclin)
UniProt: P07510 A0A6F7YAP6
LinkDB
Position
2q37.1
AA seq 517 aa
MHGGQGPLLLLLLLAVCLGAQGRNQEERLLADLMQNYDPNLRPAERDSDVVNVSLKLTLT
NLISLNEREEALTTNVWIEMQWCDYRLRWDPRDYEGLWVLRVPSTMVWRPDIVLENNVDG
VFEVALYCNVLVSPDGCIYWLPPAIFRSACSISVTYFPFDWQNCSLIFQSQTYSTNEIDL
QLSQEDGQTIEWIFIDPEAFTENGEWAIQHRPAKMLLDPAAPAQEAGHQKVVFYLLIQRK
PLFYVINIIAPCVLISSVAILIHFLPAKAGGQKCTVAINVLLAQTVFLFLVAKKVPETSQ
AVPLISKYLTFLLVVTILIVVNAVVVLNVSLRSPHTHSMARGVRKVFLRLLPQLLRMHVR
PLAPAAVQDTQSRLQNGSSGWSITTGEEVALCLPRSELLFQQWQRQGLVAAALEKLEKGP
ELGLSQFCGSLKQAAPAIQACVEACNLIACARHQQSHFDNGNEEWFLVGRVLDRVCFLAM
LSLFICGTAGIFLMAHYNRVPALPFPGDPRPYLPSPD
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgcatgggggccaggggccgctgctcctcctgctgctgctggctgtctgcctgggggcc
cagggccggaaccaggaggagcgcctgctcgcagacctgatgcaaaactacgaccccaac
ctgcggcccgcggaacgagactcggatgtggtcaatgtcagcctgaagctaaccctcacc
aacctcatctccctgaacgagcgagaggaagccctcaccaccaatgtctggatagagatg
cagtggtgcgactatcgcctgcgctgggatccgcgagactacgaaggcctgtgggtgctg
agggtgccgtccaccatggtgtggcggccggatatcgtgctggagaacaacgtggacggt
gtcttcgaggtggccctctactgcaatgtgctcgtgtcccctgacggctgtatctactgg
ctgccgcctgccatcttccgttccgcctgctctatctcagtcacctacttccccttcgac
tggcagaactgctcccttatcttccagtcccagacttacagcaccaatgagattgatctg
cagctgagtcaggaagatggccagaccatcgagtggattttcattgaccctgaggccttc
acagagaatggggagtgggccatccagcaccgaccagccaagatgctcctggacccagcg
gcgccagcccaggaagcaggccaccagaaggtggtgttctacctgctcatccagcgcaag
cccctcttctacgtcatcaacatcatcgccccctgtgtgctcatctcctctgtcgccatc
ctcatccacttccttcctgccaaggctgggggccagaagtgtaccgtcgccatcaacgtg
ctcctggcccagactgtcttcctcttccttgtggccaagaaggtgcctgaaacctcccag
gcggtgccactcatcagcaagtacctgaccttcctcctggtggtgaccatcctcattgtc
gtgaatgctgtggttgtgctcaatgtctccttgcggtctccacacacacactccatggcc
cgaggggtccgcaaggtgttcctgaggctcttgccccagctgctgaggatgcacgttcgc
ccgctggccccggcagctgtgcaggacacccagtcccggctacagaatggctcctcggga
tggtcgatcacaactggggaggaggtggccctctgcctgcctcgcagtgaactcctcttc
cagcagtggcagcggcaagggctggtggcggcagcgctggagaagctagagaaaggcccg
gagttagggctgagccagttctgtggcagcctgaagcaggctgccccagccatccaggcc
tgtgtggaagcctgcaacctcattgcctgtgcccggcaccagcagagtcactttgacaat
gggaatgaggagtggttcctggtgggccgagtgctggaccgcgtctgcttcctggccatg
ctctcgctcttcatctgtggcacagctggcatcttcctcatggcccactacaaccgggtg
ccggccctgccattccctggagatccacgcccctacctgccctcaccagactga

DBGET integrated database retrieval system