| Entry |
|
| Symbol |
COX6C
|
| Name |
(RefSeq) cytochrome c oxidase subunit 6C
|
| KO |
| K02268 | cytochrome c oxidase subunit 6c |
|
| Organism |
|
| Pathway |
| hsa04932 | Non-alcoholic fatty liver disease |
| hsa05022 | Pathways of neurodegeneration - multiple diseases |
| hsa05208 | Chemical carcinogenesis - reactive oxygen species |
|
| Module |
|
| Network |
nt06252 Mitochondrial ROS formation (cancer) nt06460 Alzheimer disease nt06466 Pathways of neurodegeneration |
| Element |
| N00998 | Electron transfer in Complex IV |
| N00999 | Mutation-caused aberrant Abeta to electron transfer in Complex IV |
| N01394 | Arsenic to electron transfer in complex IV |
|
| Brite |
KEGG Orthology (KO) [BR:hsa00001]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
1345 (COX6C)
09150 Organismal Systems
09153 Circulatory system
04260 Cardiac muscle contraction
1345 (COX6C)
09159 Environmental adaptation
04714 Thermogenesis
1345 (COX6C)
09160 Human Diseases
09161 Cancer: overview
05208 Chemical carcinogenesis - reactive oxygen species
1345 (COX6C)
09164 Neurodegenerative disease
05010 Alzheimer disease
1345 (COX6C)
05012 Parkinson disease
1345 (COX6C)
05014 Amyotrophic lateral sclerosis
1345 (COX6C)
05016 Huntington disease
1345 (COX6C)
05020 Prion disease
1345 (COX6C)
05022 Pathways of neurodegeneration - multiple diseases
1345 (COX6C)
09166 Cardiovascular disease
05415 Diabetic cardiomyopathy
1345 (COX6C)
09167 Endocrine and metabolic disease
04932 Non-alcoholic fatty liver disease
1345 (COX6C)
|
| SSDB |
|
| Motif |
|
| Other DBs |
|
| Structure |
|
| LinkDB |
|
| Position |
8:complement(99877865..99893707)
|
| AA seq |
75 aa
MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMK
DFEEMRKAGIFQSVK |
| NT seq |
228 nt +upstreamnt +downstreamnt
atggctcccgaagttttgccaaaacctcggatgcgtggccttctggccaggcgtctgcga
aatcatatggctgtagcattcgtgctatccctgggggttgcagctttgtataagtttcgt
gtggctgatcaaagaaagaaggcatacgcagatttctacagaaactacgatgtcatgaaa
gattttgaggagatgaggaaggctggtatctttcagagtgtaaagtaa |