Entry |
|
Symbol |
COX7C
|
Name |
(RefSeq) cytochrome c oxidase subunit 7C
|
KO |
K02272 | cytochrome c oxidase subunit 7c |
|
Organism |
|
Pathway |
hsa04932 | Non-alcoholic fatty liver disease |
hsa05022 | Pathways of neurodegeneration - multiple diseases |
hsa05208 | Chemical carcinogenesis - reactive oxygen species |
|
Module |
|
Network |
nt06252 Mitochondrial ROS formation (cancer) nt06460 Alzheimer disease nt06466 Pathways of neurodegeneration |
Element |
N00998 | Electron transfer in Complex IV |
N00999 | Mutation-caused aberrant Abeta to electron transfer in Complex IV |
N01394 | Arsenic to electron transfer in complex IV |
|
Brite |
KEGG Orthology (KO) [BR:hsa00001]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
1350 (COX7C)
09150 Organismal Systems
09153 Circulatory system
04260 Cardiac muscle contraction
1350 (COX7C)
09159 Environmental adaptation
04714 Thermogenesis
1350 (COX7C)
09160 Human Diseases
09161 Cancer: overview
05208 Chemical carcinogenesis - reactive oxygen species
1350 (COX7C)
09164 Neurodegenerative disease
05010 Alzheimer disease
1350 (COX7C)
05012 Parkinson disease
1350 (COX7C)
05014 Amyotrophic lateral sclerosis
1350 (COX7C)
05016 Huntington disease
1350 (COX7C)
05020 Prion disease
1350 (COX7C)
05022 Pathways of neurodegeneration - multiple diseases
1350 (COX7C)
09166 Cardiovascular disease
05415 Diabetic cardiomyopathy
1350 (COX7C)
09167 Endocrine and metabolic disease
04932 Non-alcoholic fatty liver disease
1350 (COX7C)
|
SSDB |
|
Motif |
|
Other DBs |
|
Structure |
|
LinkDB |
|
Position |
5:86617941..86620962
|
AA seq |
63 aa
MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQL
LKT |
NT seq |
192 nt +upstreamnt +downstreamnt
atgttgggccagagcatccggaggttcacaacctctgtggtccgtaggagccactatgag
gagggccctgggaagaatttgccattttcagtggaaaacaagtggtcgttactagctaag
atgtgtttgtactttggatctgcatttgctacacccttccttgtagtaagacaccaactg
cttaaaacataa |