KEGG   Homo sapiens (human): 177
Entry
177               CDS       T01001                                 
Symbol
AGER, RAGE, SCARJ1, sRAGE
Name
(RefSeq) advanced glycosylation end-product specific receptor
  KO
K19722  receptor for advanced glycosylation end products
Organism
hsa  Homo sapiens (human)
Pathway
hsa04148  Efferocytosis
hsa04613  Neutrophil extracellular trap formation
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05415  Diabetic cardiomyopathy
hsa05417  Lipid and atherosclerosis
Network
nt06460  Alzheimer disease
nt06466  Pathways of neurodegeneration
  Element
N00994  AGE-RAGE signaling pathway
N00996  Mutation-caused aberrant Abeta to AGE-RAGE signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    177 (AGER)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    177 (AGER)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    177 (AGER)
   05022 Pathways of neurodegeneration - multiple diseases
    177 (AGER)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    177 (AGER)
   05415 Diabetic cardiomyopathy
    177 (AGER)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    177 (AGER)
SSDB
Motif
Pfam: C2-set_2 Ig_3 Ig_2 I-set ig V-set Izumo-Ig Ig_4 Ig_5 C2-set_3
Other DBs
NCBI-GeneID: 177
NCBI-ProteinID: NP_001127
OMIM: 600214
HGNC: 320
Ensembl: ENSG00000204305
UniProt: Q15109 A0A1U9X785 B4DNX3
Structure
LinkDB
Position
6:complement(32180969..32184253)
AA seq 404 aa
MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEA
WKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQI
PGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRH
PETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQL
VVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYS
CVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALALGILGGLGTAALLIGV
ILWQRRQRRGEERKAPENQEEEEERAELNQSEEPEAGESSTGGP
NT seq 1215 nt   +upstreamnt  +downstreamnt
atggctgccggaacagcagttggagcctgggtgctggtcctcagtctgtggggggcagta
gtaggtgctcaaaacatcacagcccggattggcgagccactggtgctgaagtgtaagggg
gcccccaagaaaccaccccagcggctggaatggaaactgaacacaggccggacagaagct
tggaaggtcctgtctccccagggaggaggcccctgggacagtgtggctcgtgtccttccc
aacggctccctcttccttccggctgtcgggatccaggatgaggggattttccggtgccag
gcaatgaacaggaatggaaaggagaccaagtccaactaccgagtccgtgtctaccagatt
cctgggaagccagaaattgtagattctgcctctgaactcacggctggtgttcccaataag
gtggggacatgtgtgtcagagggaagctaccctgcagggactcttagctggcacttggat
gggaagcccctggtgcctaatgagaagggagtatctgtgaaggaacagaccaggagacac
cctgagacagggctcttcacactgcagtcggagctaatggtgaccccagcccggggagga
gatccccgtcccaccttctcctgtagcttcagcccaggccttccccgacaccgggccttg
cgcacagcccccatccagccccgtgtctgggagcctgtgcctctggaggaggtccaattg
gtggtggagccagaaggtggagcagtagctcctggtggaaccgtaaccctgacctgtgaa
gtccctgcccagccctctcctcaaatccactggatgaaggatggtgtgcccttgcccctt
ccccccagccctgtgctgatcctccctgagatagggcctcaggaccagggaacctacagc
tgtgtggccacccattccagccacgggccccaggaaagccgtgctgtcagcatcagcatc
atcgaaccaggcgaggaggggccaactgcaggctctgtgggaggatcagggctgggaact
ctagccctggccctggggatcctgggaggcctggggacagccgccctgctcattggggtc
atcttgtggcaaaggcggcaacgccgaggagaggagaggaaggccccagaaaaccaggag
gaagaggaggagcgtgcagaactgaatcagtcggaggaacctgaggcaggcgagagtagt
actggagggccttga

DBGET integrated database retrieval system