KEGG   Homo sapiens (human): 1789
Entry
1789              CDS       T01001                                 

Symbol
DNMT3B, FSHD4, ICF, ICF1, M.HsaIIIB
Name
(RefSeq) DNA methyltransferase 3 beta
  KO
K17399  DNA (cytosine-5)-methyltransferase 3B [EC:2.1.1.37]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00270  Cysteine and methionine metabolism
hsa01100  Metabolic pathways
hsa05206  MicroRNAs in cancer
Module
hsa_M00035  Methionine degradation
Disease
H00087  Other humoral immunodeficiencies
H02308  Immunodeficiency-centromeric instability-facial anomalies syndrome
Drug target
Azacitidine: D03021<JP/US>
Decitabine: D03665<US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    1789 (DNMT3B)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    1789 (DNMT3B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    1789 (DNMT3B)
   03032 DNA replication proteins [BR:hsa03032]
    1789 (DNMT3B)
   03036 Chromosome and associated proteins [BR:hsa03036]
    1789 (DNMT3B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.37  DNA (cytosine-5-)-methyltransferase
     1789 (DNMT3B)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys4 GATA-factors
    1789 (DNMT3B)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   DNA methylation enzymes
    1789 (DNMT3B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    1789 (DNMT3B)
SSDB
Motif
Pfam: ADD_DNMT3 DNA_methylase PWWP RBB1NT
Other DBs
NCBI-GeneID: 1789
NCBI-ProteinID: NP_008823
OMIM: 602900
HGNC: 2979
Ensembl: ENSG00000088305
Vega: OTTHUMG00000032226
Pharos: Q9UBC3(Tchem)
UniProt: Q9UBC3
LinkDB
Structure
PDB: 

Position
20q11.21
AA seq 853 aa
MKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREV
SSLLSYTQDLTGDGDGEDGDGSDTPVMPKLFRETRTRSESPAVRTRNNNSVSSRERHRPS
PRSTRGRQGRNHVDESPVEFPATRSLRRRATASAGTPWPSPPSSYLTIDLTDDTEDTHGT
PQSSSTPYARLAQDSQQGGMESPQVEADSGDGDSSEYQDGKEFGIGDLVWGKIKGFSWWP
AMVVSWKATSKRQAMSGMRWVQWFGDGKFSEVSADKLVALGLFSQHFNLATFNKLVSYRK
AMYHALEKARVRAGKTFPSSPGDSLEDQLKPMLEWAHGGFKPTGIEGLKPNNTQPVVNKS
KVRRAGSRKLESRKYENKTRRRTADDSATSDYCPAPKRLKTNCYNNGKDRGDEDQSREQM
ASDVANNKSSLEDGCLSCGRKNPVSFHPLFEGGLCQTCRDRFLELFYMYDDDGYQSYCTV
CCEGRELLLCSNTSCCRCFCVECLEVLVGTGTAAEAKLQEPWSCYMCLPQRCHGVLRRRK
DWNVRLQAFFTSDTGLEYEAPKLYPAIPAARRRPIRVLSLFDGIATGYLVLKELGIKVGK
YVASEVCEESIAVGTVKHEGNIKYVNDVRNITKKNIEEWGPFDLVIGGSPCNDLSNVNPA
RKGLYEGTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVVAMKVGDKRDISRFLECNPVM
IDAIKVSAAHRARYFWGNLPGMNRPVIASKNDKLELQDCLEYNRIAKLKKVQTITTKSNS
IKQGKNQLFPVVMNGKEDVLWCTELERIFGFPVHYTDVSNMGRGARQKLLGRSWSVPVIR
HLFAPLKDYFACE
NT seq 2562 nt   +upstreamnt  +downstreamnt
atgaagggagacaccaggcatctcaatggagaggaggacgccggcgggagggaagactcg
atcctcgtcaacggggcctgcagcgaccagtcctccgactcgcccccaatcctggaggct
atccgcaccccggagatcagaggccgaagatcaagctcgcgactctccaagagggaggtg
tccagtctgctaagctacacacaggacttgacaggcgatggcgacggggaagatggggat
ggctctgacaccccagtcatgccaaagctcttccgggaaaccaggactcgttcagaaagc
ccagctgtccgaactcgaaataacaacagtgtctccagccgggagaggcacaggccttcc
ccacgttccacccgaggccggcagggccgcaaccatgtggacgagtcccccgtggagttc
ccggctaccaggtccctgagacggcgggcaacagcatcggcaggaacgccatggccgtcc
cctcccagctcttaccttaccatcgacctcacagacgacacagaggacacacatgggacg
ccccagagcagcagtaccccctacgcccgcctagcccaggacagccagcaggggggcatg
gagtccccgcaggtggaggcagacagtggagatggagacagttcagagtatcaggatggg
aaggagtttggaataggggacctcgtgtggggaaagatcaagggcttctcctggtggccc
gccatggtggtgtcttggaaggccacctccaagcgacaggctatgtctggcatgcggtgg
gtccagtggtttggcgatggcaagttctccgaggtctctgcagacaaactggtggcactg
gggctgttcagccagcactttaatttggccaccttcaataagctcgtctcctatcgaaaa
gccatgtaccatgctctggagaaagctagggtgcgagctggcaagaccttccccagcagc
cctggagactcattggaggaccagctgaagcccatgttggagtgggcccacgggggcttc
aagcccactgggatcgagggcctcaaacccaacaacacgcaaccagtggttaataagtcg
aaggtgcgtcgtgcaggcagtaggaaattagaatcaaggaaatacgagaacaagactcga
agacgcacagctgacgactcagccacctctgactactgccccgcacccaagcgcctcaag
acaaattgctataacaacggcaaagaccgaggggatgaagatcagagccgagaacaaatg
gcttcagatgttgccaacaacaagagcagcctggaagatggctgtttgtcttgtggcagg
aaaaaccccgtgtccttccaccctctctttgagggggggctctgtcagacatgccgggat
cgcttccttgagctgttttacatgtatgatgacgatggctatcagtcttactgcactgtg
tgctgcgagggccgagagctgctgctttgcagcaacacgagctgctgccggtgtttctgt
gtggagtgcctggaggtgctggtgggcacaggcacagcggccgaggccaagcttcaggag
ccctggagctgttacatgtgtctcccgcagcgctgtcatggcgtcctgcggcgccggaag
gactggaacgtgcgcctgcaggccttcttcaccagtgacacggggcttgaatatgaagcc
cccaagctgtaccctgccattcccgcagcccgaaggcggcccattcgagtcctgtcattg
tttgatggcatcgcgacaggctacctagtcctcaaagagttgggcataaaggtaggaaag
tacgtcgcttctgaagtgtgtgaggagtccattgctgttggaaccgtgaagcacgagggg
aatatcaaatacgtgaacgacgtgaggaacatcacaaagaaaaatattgaagaatggggc
ccatttgacttggtgattggcggaagcccatgcaacgatctctcaaatgtgaatccagcc
aggaaaggcctgtatgagggtacaggccggctcttcttcgaattttaccacctgctgaat
tactcacgccccaaggagggtgatgaccggccgttcttctggatgtttgagaatgttgta
gccatgaaggttggcgacaagagggacatctcacggttcctggagtgtaatccagtgatg
attgatgccatcaaagtttctgctgctcacagggcccgatacttctggggcaacctaccc
gggatgaacaggcccgtgatagcatcaaagaatgataaactcgagctgcaggactgcttg
gaatacaataggatagccaagttaaagaaagtacagacaataaccaccaagtcgaactcg
atcaaacaggggaaaaaccaacttttccctgttgtcatgaatggcaaagaagatgttttg
tggtgcactgagctcgaaaggatctttggctttcctgtgcactacacagacgtgtccaac
atgggccgtggtgcccgccagaagctgctgggaaggtcctggagcgtgcctgtcatccga
cacctcttcgcccctctgaaggactactttgcatgtgaatag

DBGET integrated database retrieval system