KEGG   Homo sapiens (human): 27115
Entry
27115             CDS       T01001                                 

Symbol
PDE7B, bA472E5.1
Name
(RefSeq) phosphodiesterase 7B
  KO
K18436  high affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7 [EC:3.1.4.53]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa05032  Morphine addiction
Drug target
Aminophylline (DG01062): D00227 D05429<JP> D11630<US>
Bemoradan: D03075
Bucladesine (DG00230): D01238<JP> D07546
Choline theophyllinate: D02017
Diprophylline: D00691<JP>
Enprofylline: D04006
Flavoxate (DG00477): D00718<JP/US> D07961
Moxaverine (DG00045): D07089 D08238
Oxagrelate: D05278
Papaverine (DG00043): D02218<JP> D07425 D07439
Prinoxodan: D05612
Proxyphylline: D01771<JP>
Theophylline (DG01061): D00371<JP/US> D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Trapidil: D01220<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    27115 (PDE7B)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    27115 (PDE7B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     27115 (PDE7B)
SSDB
Motif
Pfam: PDEase_I
Other DBs
NCBI-GeneID: 27115
NCBI-ProteinID: NP_061818
OMIM: 604645
HGNC: 8792
Ensembl: ENSG00000171408
Vega: OTTHUMG00000015641
Pharos: Q9NP56(Tclin)
UniProt: Q9NP56
LinkDB
Position
6q23.3
AA seq 450 aa
MSCLMVERCGEILFENPDQNAKCVCMLGDIRLRGQTGVRAERRGSYPFIDFRLLNSTTYS
GEIGTKKKVKRLLSFQRYFHASRLLRGIIPQAPLHLLDEDYLGQARHMLSKVGMWDFDIF
LFDRLTNGNSLVTLLCHLFNTHGLIHHFKLDMVTLHRFLVMVQEDYHSQNPYHNAVHAAD
VTQAMHCYLKEPKLASFLTPLDIMLGLLAAAAHDVDHPGVNQPFLIKTNHHLANLYQNMS
VLENHHWRSTIGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHN
KDLRLEDAQDRHFMLQIALKCADICNPCRIWEMSKQWSERVCEEFYRQGELEQKFELEIS
PLCNQQKDSIPSIQIGFMSYIVEPLFREWAHFTGNSTLSENMLGHLAHNKAQWKSLLPRQ
HRSRGSSGSGPDHDHAGQGTESEEQEGDSP
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgtcttgtttaatggttgagaggtgtggcgaaatcttgtttgagaaccccgatcagaat
gccaaatgtgtttgcatgctgggagatatacgactaaggggtcagacgggggttcgtgct
gaacgccgtggctcctacccattcattgacttccgcctacttaacagtacaacatactca
ggggagattggcaccaagaaaaaggtgaaaagactattaagctttcaaagatacttccat
gcatcaaggctgcttcgtggaattataccacaagcccctctgcacctgctggatgaagac
taccttggacaagcaaggcatatgctctccaaagtgggaatgtgggattttgacattttc
ttgtttgatcgcttgacaaatggaaacagcctggtaacactgttgtgccacctcttcaat
acccatggactcattcaccatttcaagttagatatggtgaccttacaccgatttttagtc
atggttcaagaagattaccacagccaaaacccgtatcacaatgctgttcacgcagccgac
gtcacccaggccatgcactgctacctgaaagagccaaagcttgccagcttcctcacgcct
ctggacatcatgcttggactgctggctgcagcagcacacgatgtggaccacccaggggtg
aaccagccatttttgataaaaactaaccaccatcttgcaaacctatatcagaatatgtct
gtgctggagaatcatcactggcgatctacaattggcatgcttcgagaatcaaggcttctt
gctcatttgccaaaggaaatgacacaggatattgaacagcagctgggctccttgatcttg
gcaacagacatcaacaggcagaatgaatttttgaccagattgaaagctcacctccacaat
aaagacttaagactggaggatgcacaggacaggcactttatgcttcagatcgccttgaag
tgtgctgacatttgcaatccttgtagaatctgggagatgagcaagcagtggagtgaaagg
gtctgtgaagaattctacaggcaaggtgaacttgaacagaaatttgaactggaaatcagt
cctctttgtaatcaacagaaagattccatccctagtatacaaattggtttcatgagctac
atcgtggagccgctcttccgggaatgggcccatttcacgggtaacagcaccctgtcggag
aacatgctgggccacctcgcacacaacaaggcccagtggaagagcctgttgcccaggcag
cacagaagcaggggcagcagtggcagcgggcctgaccacgaccacgcaggccaagggact
gagagcgaggagcaggaaggcgacagcccctag

DBGET integrated database retrieval system