KEGG   Homo sapiens (human): 2879
Entry
2879              CDS       T01001                                 
Symbol
GPX4, GPx-4, GSHPx-4, MCSP, PHGPx, SMDS, snGPx, snPHGPx
Name
(RefSeq) glutathione peroxidase 4
  KO
K05361  phospholipid-hydroperoxide glutathione peroxidase [EC:1.11.1.12]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa01100  Metabolic pathways
hsa04216  Ferroptosis
Network
nt06026  Glutathione biosynthesis
  Element
N00899  Glutathione biosynthesis
Disease
H01825  Spondylometaphyseal dysplasia, Sedaghatian type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2879 (GPX4)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    2879 (GPX4)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.12  phospholipid-hydroperoxide glutathione peroxidase
     2879 (GPX4)
SSDB
Motif
Pfam: GSHPx AhpC-TSA
Other DBs
NCBI-GeneID: 2879
NCBI-ProteinID: NP_002076
OMIM: 138322
HGNC: 4556
Ensembl: ENSG00000167468
Vega: OTTHUMG00000181874
Pharos: P36969(Tbio)
UniProt: P36969
Structure
LinkDB
Position
19:1103994..1106779
AA seq 197 aa
MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYR
GFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFA
AGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRY
GPMEEPLVIEKDLPHYF
NT seq 594 nt   +upstreamnt  +downstreamnt
atgagcctcggccgcctttgccgcctactgaagccggcgctgctctgtggggctctggcc
gcgcctggcctggccgggaccatgtgcgcgtcccgggacgactggcgctgtgcgcgctcc
atgcacgagttttccgccaaggacatcgacgggcacatggttaacctggacaagtaccgg
ggcttcgtgtgcatcgtcaccaacgtggcctcccagtgaggcaagaccgaagtaaactac
actcagctcgtcgacctgcacgcccgatacgctgagtgtggtttgcggatcctggccttc
ccgtgtaaccagttcgggaagcaggagccagggagtaacgaagagatcaaagagttcgcc
gcgggctacaacgtcaaattcgatatgttcagcaagatctgcgtgaacggggacgacgcc
cacccgctgtggaagtggatgaagatccaacccaagggcaagggcatcctgggaaatgcc
atcaagtggaacttcaccaagttcctcatcgacaagaacggctgcgtggtgaagcgctac
ggacccatggaggagcccctggtgatagagaaggacctgccccactatttctag

DBGET integrated database retrieval system